Dyella japonica: HY57_02590 Help Entry HY57_02590        CDS       T03215                                  Name (GenBank) acetolactate synthase   KO K01653   acetolactate synthase I/III small subunit [EC:2.2.1.6] Organism dja  Dyella japonica Pathway dja00290   Valine, leucine and isoleucine biosynthesis dja00650   Butanoate metabolism dja00660   C5-Branched dibasic acid metabolism dja00770   Pantothenate and CoA biosynthesis dja01100   Metabolic pathways dja01110   Biosynthesis of secondary metabolites dja01210   2-Oxocarboxylic acid metabolism dja01230   Biosynthesis of amino acids Module dja_M00019   Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine dja_M00570   Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine Brite KEGG Orthology (KO) [BR:dja00001]  09100 Metabolism   09101 Carbohydrate metabolism    00650 Butanoate metabolism     HY57_02590    00660 C5-Branched dibasic acid metabolism     HY57_02590   09105 Amino acid metabolism    00290 Valine, leucine and isoleucine biosynthesis     HY57_02590   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     HY57_02590 Enzymes [BR:dja01000]  2. Transferases   2.2  Transferring aldehyde or ketonic groups    2.2.1  Transketolases and transaldolases     2.2.1.6  acetolactate synthase      HY57_02590 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACT_AHAS_ss ACT_5 ACT ACT_4 Pox_TAA1 ACT_8 Motif Other DBs NCBI-ProteinID:  AIF46219 UniProt:  A0A075JWG5 LinkDB All DBs Position 625582..625824 Genome browser AA seq 80 aa AA seqDB search MKHTLSILLQNESGALMRVAGMFAARHCNIDSLTVAATDDPEVSQLTLVMHGADDTVEQI IKQTRKLVDVIDVSHPAATP NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgaaacacacactttccatcctgctgcaaaacgaatccggcgcactgatgcgtgtggcc ggcatgttcgccgcacgccactgcaacatcgattcgctgacggtcgccgccaccgatgac ccggaagtctcgcagctcaccctggtcatgcacggcgcggacgatacggtggagcagatc atcaagcagacccgcaagctggtggacgtgatcgacgtcagccatcccgccgccacgcca tga

DBGET integrated database retrieval system