Dyella japonica: HY57_04110 Help Entry HY57_04110        CDS       T03215                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism dja  Dyella japonica Pathway dja01100   Metabolic pathways dja01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dja00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HY57_04110    00074 Mycolic acid biosynthesis     HY57_04110   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HY57_04110 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AIF46503 UniProt:  A0A075K2T1 LinkDB All DBs Position 964955..965224 Genome browser AA seq 89 aa AA seqDB search MAEQSSAQHELATLIVDSLNLETVTADQIDPDAPLFGGDLGLDSIDALEIALAVSKRYGF QLRSDNPENRKIFTSLRTLSEHVEQHRAV NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atggccgagcagagcagcgcacaacacgaactggccacgttgatcgtggacagcctcaat ctggaaaccgtcacggccgaccagattgacccggatgccccgcttttcggcggcgatctg ggcctggattccatcgacgcgctggaaatcgcgctggcggtgtccaagcgctacgggttc cagctgcgttcggacaaccccgagaatcgcaagatcttcaccagcctgcgcaccctgtcc gaacacgtcgaacagcaccgcgccgtttaa

DBGET integrated database retrieval system