KEGG   Dyella japonica: HY57_17090
Entry
HY57_17090        CDS       T03215                                 
Name
(GenBank) hypothetical protein
  KO
K02477  two-component system, LytTR family, response regulator
Organism
dja  Dyella japonica
Brite
KEGG Orthology (KO) [BR:dja00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:dja02022]
    HY57_17090
Two-component system [BR:dja02022]
 LytTR family
  Unclassified
   HY57_17090
SSDB
Motif
Pfam: Response_reg LytTR DUF7380
Other DBs
NCBI-ProteinID: AIF48833
UniProt: A0A075K9E6
LinkDB
Position
3978295..3979044
AA seq 249 aa
MTERNAVPTLIVDDEPLARAGLRHLLQEIDWIRCVGEAADGEAAIEAIHRLQPELILLDV
QMPGCSGIDVLRRLPPPAPRIIFTTAYAEHAVAAFELGALDYLLKPFGASRLATALDRVR
ASLGEPLPPALDRYGEMLAHGPMQRLFVRSGRSIQPLAVADIYWFEAVGDYVMAHTASGD
YVLHLALSRLEARLDPQCFARIHRAHLINLGQLTRFRRELDGRLTAVLHNGTALPVSKSK
AQVFRELAR
NT seq 750 nt   +upstreamnt  +downstreamnt
atgactgagcgcaacgcggtgccaaccctcatcgtcgacgacgagcccctggcccgcgcc
ggcttgcgtcacctgttgcaggagatcgactggattcgctgcgtaggcgaagcggcggat
ggcgaggccgccatcgaggcgattcaccggttgcagcccgagctgatcttgctggatgtg
cagatgcccgggtgctcaggcatcgacgtgttgcgtcgcctgccgccgcctgctccgcgc
atcatcttcaccaccgcatacgccgaacacgccgtggccgccttcgaactcggcgcgctc
gattacctgctcaaaccctttggggcgagccgcctcgccacggccctcgaccgggttcgc
gcctcgctgggcgaacccctgccacccgcactcgaccgctacggcgagatgctggcccat
ggccccatgcaacggcttttcgtgcgcagcggacgcagcatccagccgctggccgtggcc
gacatctactggttcgaggcggtgggcgactacgtgatggcgcacaccgccagcggcgac
tacgtcctgcacctggcactcagccgccttgaggcgcgactggaccctcagtgctttgcc
cgcatccatcgcgcgcacctcatcaatctcggccagctgacgcgcttccggcgtgagctt
gatggccggctgacggccgtcctgcataacggcacggcattgccggtcagcaaaagcaag
gcacaggtgtttcgcgaactggcgcgttga

DBGET integrated database retrieval system