Dyella japonica: HY57_17090
Help
Entry
HY57_17090 CDS
T03215
Name
(GenBank) hypothetical protein
KO
K02477
two-component system, LytTR family, response regulator
Organism
dja
Dyella japonica
Brite
KEGG Orthology (KO) [BR:
dja00001
]
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02022 Two-component system [BR:
dja02022
]
HY57_17090
Two-component system [BR:
dja02022
]
LytTR family
Unclassified
HY57_17090
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Response_reg
LytTR
DUF7380
Motif
Other DBs
NCBI-ProteinID:
AIF48833
UniProt:
A0A075K9E6
LinkDB
All DBs
Position
3978295..3979044
Genome browser
AA seq
249 aa
AA seq
DB search
MTERNAVPTLIVDDEPLARAGLRHLLQEIDWIRCVGEAADGEAAIEAIHRLQPELILLDV
QMPGCSGIDVLRRLPPPAPRIIFTTAYAEHAVAAFELGALDYLLKPFGASRLATALDRVR
ASLGEPLPPALDRYGEMLAHGPMQRLFVRSGRSIQPLAVADIYWFEAVGDYVMAHTASGD
YVLHLALSRLEARLDPQCFARIHRAHLINLGQLTRFRRELDGRLTAVLHNGTALPVSKSK
AQVFRELAR
NT seq
750 nt
NT seq
+upstream
nt +downstream
nt
atgactgagcgcaacgcggtgccaaccctcatcgtcgacgacgagcccctggcccgcgcc
ggcttgcgtcacctgttgcaggagatcgactggattcgctgcgtaggcgaagcggcggat
ggcgaggccgccatcgaggcgattcaccggttgcagcccgagctgatcttgctggatgtg
cagatgcccgggtgctcaggcatcgacgtgttgcgtcgcctgccgccgcctgctccgcgc
atcatcttcaccaccgcatacgccgaacacgccgtggccgccttcgaactcggcgcgctc
gattacctgctcaaaccctttggggcgagccgcctcgccacggccctcgaccgggttcgc
gcctcgctgggcgaacccctgccacccgcactcgaccgctacggcgagatgctggcccat
ggccccatgcaacggcttttcgtgcgcagcggacgcagcatccagccgctggccgtggcc
gacatctactggttcgaggcggtgggcgactacgtgatggcgcacaccgccagcggcgac
tacgtcctgcacctggcactcagccgccttgaggcgcgactggaccctcagtgctttgcc
cgcatccatcgcgcgcacctcatcaatctcggccagctgacgcgcttccggcgtgagctt
gatggccggctgacggccgtcctgcataacggcacggcattgccggtcagcaaaagcaag
gcacaggtgtttcgcgaactggcgcgttga
DBGET
integrated database retrieval system