Dyella jiangningensis: CH75_04130 Help Entry CH75_04130        CDS       T03074                                  Name (GenBank) glutaredoxin   KO K03676   glutaredoxin 3 Organism dji  Dyella jiangningensis Brite KEGG Orthology (KO) [BR:dji00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:dji03110]     CH75_04130 Chaperones and folding catalysts [BR:dji03110]  Protein folding catalysts   Protein disulfide isomerase    CH75_04130 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_2 GST_N_3 Glrx-like SH3BGR Thioredoxin_3 DSBA GST_N Motif Other DBs NCBI-ProteinID:  AHX12601 LinkDB All DBs Position 917753..918016 Genome browser AA seq 87 aa AA seqDB search MPKIEVYSTAVCPYCVSAKNLLKSKGLEWTEVRVDTDPAQREAMLARSGGRRTVPQIFIN GHHVGGFDDLAAADRNGKLAQLLEITA NT seq 264 nt NT seq  +upstreamnt  +downstreamnt gtgcccaagatcgaggtctattccaccgcagtatgcccctactgcgtgtccgccaagaac ctgctcaagtccaagggactggagtggacggaggtgcgtgtcgataccgacccggcgcag cgcgaagcgatgctggcgcgcagcggtgggcgtcgcacggtgccgcagattttcatcaat ggtcaccacgtcggcggcttcgacgacctcgccgccgccgaccgcaacggcaagctggcc cagctgctggagatcaccgcatga

DBGET integrated database retrieval system