Dyella jiangningensis: CH75_20305
Help
Entry
CH75_20305 CDS
T03074
Name
(GenBank) membrane protein insertase YidC
KO
K03217
YidC/Oxa1 family membrane protein insertase
Organism
dji
Dyella jiangningensis
Pathway
dji02024
Quorum sensing
dji03060
Protein export
dji03070
Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:
dji00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
03060 Protein export
CH75_20305
09130 Environmental Information Processing
09131 Membrane transport
03070 Bacterial secretion system
CH75_20305
09140 Cellular Processes
09145 Cellular community - prokaryotes
02024 Quorum sensing
CH75_20305
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03029 Mitochondrial biogenesis [BR:
dji03029
]
CH75_20305
09183 Protein families: signaling and cellular processes
02044 Secretion system [BR:
dji02044
]
CH75_20305
Mitochondrial biogenesis [BR:
dji03029
]
Mitochondrial quality control factors
Mitochondrial respiratory chain complex assembly factors
Complex-IV assembly factors
CH75_20305
Secretion system [BR:
dji02044
]
Sec (secretion) system
Prokaryotic Sec-SRP core components
CH75_20305
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
YidC_periplas
60KD_IMP
Motif
Other DBs
NCBI-ProteinID:
AHX15296
LinkDB
All DBs
Position
complement(4423835..4425535)
Genome browser
AA seq
566 aa
AA seq
DB search
MNQTRTFLLFALMAVAYLLYMAWDKDYGSHPQPAVASSSTVATPTDSSVPGATANTPASP
AAVPGTTTEASAQLVTISTDVLRLTVDTRGGTVVRSELLNYPAVPRTKKDPDPAPVRLLD
DERSQYFVAQSGLVSNQGAAPDHRAVFQAAQTSYALAQGQDELKVDLTWSDAAGLKVTKT
YALKRGSYVVTLDQKIENGGSTAWQGNAYEQLQRVAPVQQKSWWQNFSDPSSHSFYGAAW
YSPEEKMTTLPFADFAKKPLNHAITGGWASMLQHYFFVAWIPAAQDANTYSTSVINADTA
QPVYLIRSVGPSLSVAPGQSVATASRLYVGPKLQGTLDTVAPGLDLTTNYGWLTVVAQPL
HWLLSQLHSISGNWGVAIILLVLLLKAALWKLTAAQFRSGAKMRKLQPRVTALKERYGDD
KMKMQQAMMELYKKEKVNPMSGCLPVLITMPVFFGLYRVLMESVELRHSPFFGWIHDLSA
PDPFFVLPVIYILVMLATQWLSPSAAGMDPAQQKMMKVMPVVFGFMFLFFPAGLVLYWVV
NGITSLAQQWLITRSVERADEKAKAA
NT seq
1701 nt
NT seq
+upstream
nt +downstream
nt
atgaatcaaacgcgtacgttcctcctcttcgccctgatggccgtggcctatctgctgtac
atggcctgggacaaggattacggctcgcacccgcagcctgcggtcgcctcgtcgtccacc
gtggcgacgccgaccgacagcagcgtgccgggtgccacggcgaacacgcccgcctcgccg
gcggccgtgccgggcaccaccacggaagcgtccgcgcaactcgtcaccatcagcaccgac
gtgctgcgcctcaccgtggatacccgcggcggaaccgtggtgcgttcggaattgctcaac
tatccggcggtgccacgcaccaagaaggatccggaccccgcaccggtgcgcctgctcgat
gacgagcgttcgcagtacttcgtggcgcagagcggcctggtgagcaaccagggcgcggcg
cccgatcaccgcgccgtgttccaggcggcgcagaccagttatgcgctggcgcagggccag
gacgaactcaaggtcgacctcacctggagcgacgccgcaggcctgaaggtcaccaagacc
tatgcgctcaagcgcggcagctatgtggtcaccctcgaccagaagatcgagaacggcggc
agcaccgcgtggcagggcaacgcctacgagcagctgcagcgcgtggccccggtgcaacag
aagagctggtggcagaacttcagcgacccgtcctcgcacagcttctacggcgcggcgtgg
tacagccccgaagagaagatgaccaccctgcccttcgccgacttcgccaagaagccgctg
aaccatgcgattaccggtggctgggcctcgatgctgcagcactacttcttcgtcgcctgg
attccggcggcgcaggacgccaacacctacagcaccagcgtgatcaatgcggatacggct
cagccggtgtacctgatccgctcggtcggcccgtcactcagcgtggcgccgggccagagc
gtggccaccgcgtcgcgtctctacgtgggtccgaagctgcagggcacgctcgacaccgtg
gcgccgggcctcgacctcaccaccaactacggctggctgaccgtggtggcgcagccgctg
cattggctgctttcccagctgcactcgatcagcggcaactggggcgtcgccatcatcctc
ctggtgctgctgctgaaggccgcgctgtggaagctgaccgccgcgcagttccgttccggc
gccaagatgcgcaagctgcagccgcgcgtgactgctctcaaggagcgttacggcgacgac
aagatgaagatgcagcaggccatgatggagctgtacaagaaggagaaggtcaacccgatg
tcgggctgcctgccggtgctcatcacgatgccggtgttcttcggcctgtaccgcgtgctg
atggaaagcgtggagctccgccactcgccgttcttcggctggatccacgatctttccgcg
cccgatccgttcttcgtgctgccggtgatctacatcctggtgatgctggccacgcagtgg
ctgtcgccttccgccgcgggcatggatccggcacagcagaagatgatgaaggtgatgccg
gtggtgttcggcttcatgttcctgttcttcccggcgggcctggtgctgtactgggtggtc
aacggcatcaccagcctggcgcagcagtggttgatcacgcgtagcgtggagcgcgcggac
gagaaggccaaggcggcctga
DBGET
integrated database retrieval system