KEGG   Dyella jiangningensis: CH75_22210
Entry
CH75_22210        CDS       T03074                                 
Symbol
uvrD
Name
(GenBank) DNA-dependent helicase II
  KO
K03657  ATP-dependent DNA helicase UvrD/PcrA [EC:5.6.2.4]
Organism
dji  Dyella jiangningensis
Pathway
dji03420  Nucleotide excision repair
dji03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:dji00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    CH75_22210 (uvrD)
   03430 Mismatch repair
    CH75_22210 (uvrD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:dji03400]
    CH75_22210 (uvrD)
Enzymes [BR:dji01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.4  DNA 3'-5' helicase
     CH75_22210 (uvrD)
DNA repair and recombination proteins [BR:dji03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     CH75_22210 (uvrD)
   MMR (mismatch excision repair)
    Other MMR factors
     CH75_22210 (uvrD)
SSDB
Motif
Pfam: UvrD_C UvrD-helicase AAA_19 UvrD_C_2 PcrA_UvrD_tudor AAA_30 AAA_12 Viral_helicase1
Other DBs
NCBI-ProteinID: AHX15642
LinkDB
Position
complement(4855416..4857611)
AA seq 731 aa
MDVSHLIDKLNDAQREAVCAPPGNYLVLAGAGSGKTRVLTHRIGWLTQVEHISPWAILAV
TFTNKAAGEMRARLDQLIPGGTQGLTVGTFHGIAHRLLRRHWREAGLPEGFQILDADDQQ
RIVKRVVTGLGLDEARFPPRQATWQINQWKDEGKRADTIEHRDHPMTRTLVQIYQAYEEA
CRRAGLVDFAELLLRAHELWLNNPQILDHYRDRWRYLLIDEFQDTNTLQYAWIRVLAGNT
GQVFVVGDDDQAIYGWRGAKVENVQQFLRDFPGAKTIKLEQNYRSTATILKAANSVIARN
GGRLGKQLWTDGGDGERIALYASYNEQDEARFVVERIREYVAEHGEARDIAILYRSNAQS
RNFEEQLMQRDIRFRVYGGQRFFDRAEIKDALAYLRLSSNRHDDAAFERAVNTPPRGIGD
RTLDVLRRRAREERSSMWESALSELSGGRELAGRAKNAVKAFLSMIEDMARAFAGTETGN
ALALAEQIDHAITHSGLRDFYEKDSRGNAESRVENLDELVNVASRFELTPDDVEAGLSEL
AAFLSHAALEAGEGQGESWDDCVQLMTLHSAKGLEFPVVFLVGMEEGLFPSQRSVEDEGR
LEEERRLAYVGITRARERLFITYAESRRMHGVEMLARPSRFLAEIPPELIDEVRPRVQVS
RPLYGARPTGGSISLDEPMPLKLGQRVSHPSFGEGVVVSAEGSGAHMRIQVNFASAGSKW
LVYAYANLTPM
NT seq 2196 nt   +upstreamnt  +downstreamnt
atggatgtctcccacctgatcgacaagctcaacgatgcgcagcgcgaagcggtctgcgcc
ccacccggcaactacctcgtgctcgctggcgccggctccggcaagacccgcgtgctcacg
caccgcatcggctggctcacgcaggtggaacacatctcgccgtgggcgatcctcgcggtg
accttcaccaacaaggccgcgggcgagatgcgcgcgcgtctggaccagttgattccgggt
ggaacgcagggtcttaccgtgggcaccttccacggcatcgcccatcgcctgctgcgtcgc
cattggcgcgaagcggggctgccggaaggtttccagattctcgatgcagacgaccagcag
cgcatcgtcaagcgcgtggtcaccgggctgggcctggacgaagcgcgttttccgccgcgc
caggccacgtggcagatcaaccagtggaaggacgagggcaagcgcgccgacaccatcgag
caccgcgatcatccgatgacgcgcacgctcgtgcagatctaccaggcctatgaagaggcc
tgccgtcgcgcgggtctggtggatttcgccgagctgctgttgcgcgcgcacgagctgtgg
ttgaacaacccgcagatcctcgatcattaccgtgatcgctggcgctacctgctgatcgac
gagttccaggacaccaacaccttgcaatacgcgtggatccgcgtgctcgccggcaacacc
ggccaggtgttcgtggtgggcgacgacgaccaggccatctatggctggcgcggcgccaag
gtggagaacgtgcagcagttcctgcgcgatttccccggcgccaagaccatcaagctggaa
cagaactaccgctccaccgcgactatcctcaaggccgccaacagcgtgatcgcgcgcaac
ggcggccgccttggcaagcagctgtggactgacggcggcgacggcgagcgcatcgcgctg
tatgcctcgtacaacgagcaggacgaagcacgcttcgtggtggagcgcatccgcgagtac
gtcgccgaacacggcgaggcgcgcgacatcgcgatcctctatcggtccaatgcgcagtcg
cgcaacttcgaagaacagctgatgcagcgggacatccgcttccgcgtgtacggcggccag
cgcttcttcgatcgcgccgaaatcaaggacgcgctcgcctacctgcgcctgtcttccaat
cgccacgatgacgcggcgttcgagcgggcggtgaacacgccgccgcggggcatcggcgat
cgcacgctggacgtgttgcgacgtcgcgcgcgcgaagaacgcagctcgatgtgggagtcc
gcgctcagcgagttgagcggcggcagggaactggccggtcgcgcgaagaacgcggtaaag
gccttcctctcgatgatcgaggacatggcgcgcgcgttcgccggcactgagacgggcaac
gcactcgcgctggccgaacagatcgaccacgccatcacccacagcggactgcgcgacttc
tacgagaaagacagtcgcggcaacgccgaatcccgcgtggagaacctggacgaactggtc
aatgtcgccagccgcttcgagctcacgcccgatgatgtcgaagcgggcctgagcgaactt
gccgcattcctctcgcatgccgcgctcgaagcgggcgagggccagggcgaatcctgggac
gactgcgtgcagttgatgacgctgcattcggctaagggcctggaatttcccgtggtgttc
ctggtcggcatggaggaaggcttgttccccagccagcgctcggtggaagacgaaggccgt
ctagaagaggagcgccgcctcgcctacgtgggcatcacgcgcgcacgcgaacggctgttc
atcacgtacgccgaatcgcgtcgcatgcatggcgtggaaatgctggcgcggccgtcgcgc
tttctagcggagatcccgccggaactcatcgacgaagtgcgcccgcgtgtgcaagtgagc
cgcccgctgtatggcgcgcgtccgaccggcggttcgatctcgctggacgaacccatgccg
ctcaagctggggcaacgcgtcagccacccgagcttcggtgaaggagtggtggtgagtgcc
gagggcagcggtgcgcatatgcgcatccaggtgaacttcgcctcggcgggcagcaagtgg
ctggtctatgcctatgccaacctgacgcccatgtga

DBGET integrated database retrieval system