Dokdonella koreensis: I596_1660 Help Entry I596_1660         CDS       T04377                                  Name (GenBank) Cell division protein FtsB   KO K05589   cell division protein FtsB Organism dko  Dokdonella koreensis Brite KEGG Orthology (KO) [BR:dko00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:dko03036]     I596_1660 Chromosome and associated proteins [BR:dko03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     I596_1660 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DivIC ZapB DUF7310 bZIP_1 ACBP4_C XRCC4_CC SlyX Motif Other DBs NCBI-ProteinID:  ANB17684 UniProt:  A0A160DTY0 LinkDB All DBs Position 1915867..1916169 Genome browser AA seq 100 aa AA seqDB search MLRYAALLLLIALIALQVKLWTGQGGMRDIWTLEARIAEQRAENEKLKARNDALAADVED LKHGNAAVEERARSELGLIKPGETFYHVVEPAGPKPGERK NT seq 303 nt NT seq  +upstreamnt  +downstreamnt gtgctgcgctacgccgccctgctgctgctgattgcgctgatcgcgctacaggtcaagctg tggaccgggcagggcggcatgcgcgacatctggacgctcgaggcgcgcatcgccgagcag agggccgagaacgagaagctcaaggcgcgcaacgacgccttggcggcggacgtggaggac ctcaagcacgggaatgcggcggtcgaggaacgcgcgcgttcggagctgggcctcatcaag cccggcgagaccttctatcacgtggtggaaccggccggcccgaagccgggcgagcgcaag tga

DBGET integrated database retrieval system