Dokdonella koreensis: I596_3378 Help Entry I596_3378         CDS       T04377                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism dko  Dokdonella koreensis Pathway dko01100   Metabolic pathways dko01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dko00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     I596_3378    00074 Mycolic acid biosynthesis     I596_3378   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     I596_3378 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ANB19367 UniProt:  A0A160DXD8 LinkDB All DBs Position 3880027..3880290 Genome browser AA seq 87 aa AA seqDB search MHDPLEQEIKLLIIEALNLEDVDAADIDPEAPLFVDGLGLDSIDALELGLALQKRYGVTL SAESEETRRHFASVRALAGFVAASRTA NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgcacgacccgctggagcaggagatcaagctgttgatcatcgaggcgctcaacctggaa gacgtcgacgctgccgacatcgacccggaggccccgctgttcgtcgacggcctggggctg gactcgatcgatgcgctggagctgggcctggccctgcagaagcgctacggcgtgacgctg tcggccgagtcggaggaaacccgccgccattttgccagcgtccgcgccctggccggcttc gtcgccgcctcgcggactgcgtga

DBGET integrated database retrieval system