Delftia lacustris: I6G47_04500 Help Entry I6G47_04500       CDS       T06974                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism dla  Delftia lacustris Brite KEGG Orthology (KO) [BR:dla00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:dla03036]     I6G47_04500    03400 DNA repair and recombination proteins [BR:dla03400]     I6G47_04500 Chromosome and associated proteins [BR:dla03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     I6G47_04500 DNA repair and recombination proteins [BR:dla03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       I6G47_04500 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS PLC-beta_C Motif Other DBs NCBI-ProteinID:  QPS82354 UniProt:  A0A1H3J0H4 LinkDB All DBs Position complement(962189..962464) Genome browser AA seq 91 aa AA seqDB search MSNTYKELLAQREALEAQIQTARKQEVSDVIAKIRGLVQDYGLTADDIFTARRASSTVAP KFRNPETGDTWTGRGKPPAWIKDKDRAQFAI NT seq 276 nt NT seq  +upstreamnt  +downstreamnt gtgagcaacacatacaaagaacttctggcgcagcgcgaagcacttgaggcccagatccag acagcacgcaagcaagaagtcagtgatgtgatcgccaagattcgcggtctggttcaggat tacggcctgacagccgacgacattttcacggcacgccgcgcctcctccaccgtggctccc aagttccgcaatccagagacaggtgacacctggaccggacgcggcaagccgcccgcctgg ataaaggacaaggatcgcgcccagttcgccatctga

DBGET integrated database retrieval system