Delftia lacustris: I6G47_15725 Help Entry I6G47_15725       CDS       T06974                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism dla  Delftia lacustris Brite KEGG Orthology (KO) [BR:dla00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:dla03036]     I6G47_15725    03400 DNA repair and recombination proteins [BR:dla03400]     I6G47_15725 Chromosome and associated proteins [BR:dla03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     I6G47_15725 DNA repair and recombination proteins [BR:dla03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       I6G47_15725 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS SAP_new25 Motif Other DBs NCBI-ProteinID:  QPS84419 UniProt:  A0A7T2YYY6 LinkDB All DBs Position 3377080..3377361 Genome browser AA seq 93 aa AA seqDB search MTSDYKTLLQQKAELEAKIAHALATEKSGVVARVRSLIEEFHLTPDDVFGGSKRKASAGA AKYRDPGTGATWTGRGKPPNWIKDAADRTSFEI NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgacatccgattacaagacacttcttcagcagaaggctgaacttgaagccaagattgcc cacgctctggccacagaaaagtctggcgtggtcgcccgcgtgcgcagcctgatcgaggaa ttccacctgactccagacgatgtgttcggaggctccaaacgcaaagcttcggctggcgcg gccaagtaccgcgatcctggtaccggcgctacgtggacggggcgtggcaagccgcccaac tggatcaaggatgctgcggatcggacctctttcgagatctga

DBGET integrated database retrieval system