Delftia lacustris: I6G47_17330 Help Entry I6G47_17330       CDS       T06974                                  Symbol ftsL Name (GenBank) cell division protein FtsL   KO K03586   cell division protein FtsL Organism dla  Delftia lacustris Brite KEGG Orthology (KO) [BR:dla00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:dla03036]     I6G47_17330 (ftsL) Chromosome and associated proteins [BR:dla03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     I6G47_17330 (ftsL) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FtsL DivIC Motif Other DBs NCBI-ProteinID:  QPS78791 UniProt:  A0A1H3QA01 LinkDB All DBs Position complement(3691246..3691530) Genome browser AA seq 94 aa AA seqDB search MLRLNLVLLLAVMASAIFLVHNQYESRRLFTELDRAVAESRRLATEQQRLQVEKRAQATP QRIEVMARERLQMKPATPAIAQYVNDDARTGVAP NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgctgcgcctgaacctcgtgctgctgctggcggtgatggccagcgccatcttcctggtg cacaaccagtacgagtcgcgccggctgttcaccgaactggaccgcgccgtggccgaatcg cgccgcctggccaccgagcagcagcgcctgcaggtggaaaagcgcgcccaggccacgccg cagcgcatcgaggtcatggcgcgcgagcgtctgcagatgaagccggccacgccggccatc gcccagtacgtcaatgacgatgcgcgcacgggagtggctccatga

DBGET integrated database retrieval system