Delftia lacustris: I6G47_30485 Help Entry I6G47_30485       CDS       T06974                                  Symbol ftsB Name (GenBank) cell division protein FtsB   KO K05589   cell division protein FtsB Organism dla  Delftia lacustris Brite KEGG Orthology (KO) [BR:dla00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:dla03036]     I6G47_30485 (ftsB) Chromosome and associated proteins [BR:dla03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     I6G47_30485 (ftsB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DivIC BicD HALZ PDXDC1-like_cen2 TENA_THI-4 Motif Other DBs NCBI-ProteinID:  QPS81237 UniProt:  A0A1H3GEE8 LinkDB All DBs Position complement(6562034..6562312) Genome browser AA seq 92 aa AA seqDB search MVNRVVPLVLLALLAAVHAQLWLGHGSVAYVKELQQQIHDQNVANALEKAENDRLASEVN DLKDGLAMVEEKARSELGMVKPNEIFVQIVRR NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atggtcaaccgcgtcgtcccccttgtcctgctcgccctgctggctgccgtgcacgcgcag ctgtggctgggccacggcagcgtggcctatgtgaaggaactgcagcagcagatccacgac cagaacgtggccaacgcgctggaaaaagccgagaacgaccgcctggcctccgaggtcaac gacctcaaggacggcctggccatggtcgaggaaaaggcccgcagcgagctgggcatggtc aagcccaacgagatctttgtgcagatcgtgcggcgctga

DBGET integrated database retrieval system