KEGG   Delphinapterus leucas (beluga whale): 111163022
Entry
111163022         CDS       T05885                                 
Symbol
MAPK1
Name
(RefSeq) mitogen-activated protein kinase 1 isoform X1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01521  EGFR tyrosine kinase inhibitor resistance
dle01522  Endocrine resistance
dle01524  Platinum drug resistance
dle04010  MAPK signaling pathway
dle04012  ErbB signaling pathway
dle04014  Ras signaling pathway
dle04015  Rap1 signaling pathway
dle04022  cGMP-PKG signaling pathway
dle04024  cAMP signaling pathway
dle04062  Chemokine signaling pathway
dle04066  HIF-1 signaling pathway
dle04068  FoxO signaling pathway
dle04071  Sphingolipid signaling pathway
dle04072  Phospholipase D signaling pathway
dle04114  Oocyte meiosis
dle04140  Autophagy - animal
dle04148  Efferocytosis
dle04150  mTOR signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04210  Apoptosis
dle04218  Cellular senescence
dle04261  Adrenergic signaling in cardiomyocytes
dle04270  Vascular smooth muscle contraction
dle04350  TGF-beta signaling pathway
dle04360  Axon guidance
dle04370  VEGF signaling pathway
dle04371  Apelin signaling pathway
dle04380  Osteoclast differentiation
dle04510  Focal adhesion
dle04517  IgSF CAM signaling
dle04520  Adherens junction
dle04540  Gap junction
dle04550  Signaling pathways regulating pluripotency of stem cells
dle04611  Platelet activation
dle04613  Neutrophil extracellular trap formation
dle04620  Toll-like receptor signaling pathway
dle04621  NOD-like receptor signaling pathway
dle04625  C-type lectin receptor signaling pathway
dle04650  Natural killer cell mediated cytotoxicity
dle04657  IL-17 signaling pathway
dle04658  Th1 and Th2 cell differentiation
dle04659  Th17 cell differentiation
dle04660  T cell receptor signaling pathway
dle04662  B cell receptor signaling pathway
dle04664  Fc epsilon RI signaling pathway
dle04666  Fc gamma R-mediated phagocytosis
dle04668  TNF signaling pathway
dle04713  Circadian entrainment
dle04720  Long-term potentiation
dle04722  Neurotrophin signaling pathway
dle04723  Retrograde endocannabinoid signaling
dle04724  Glutamatergic synapse
dle04725  Cholinergic synapse
dle04726  Serotonergic synapse
dle04730  Long-term depression
dle04810  Regulation of actin cytoskeleton
dle04910  Insulin signaling pathway
dle04912  GnRH signaling pathway
dle04914  Progesterone-mediated oocyte maturation
dle04915  Estrogen signaling pathway
dle04916  Melanogenesis
dle04917  Prolactin signaling pathway
dle04919  Thyroid hormone signaling pathway
dle04921  Oxytocin signaling pathway
dle04926  Relaxin signaling pathway
dle04928  Parathyroid hormone synthesis, secretion and action
dle04929  GnRH secretion
dle04930  Type II diabetes mellitus
dle04933  AGE-RAGE signaling pathway in diabetic complications
dle04934  Cushing syndrome
dle04935  Growth hormone synthesis, secretion and action
dle04960  Aldosterone-regulated sodium reabsorption
dle05010  Alzheimer disease
dle05020  Prion disease
dle05022  Pathways of neurodegeneration - multiple diseases
dle05034  Alcoholism
dle05132  Salmonella infection
dle05133  Pertussis
dle05135  Yersinia infection
dle05140  Leishmaniasis
dle05142  Chagas disease
dle05145  Toxoplasmosis
dle05152  Tuberculosis
dle05160  Hepatitis C
dle05161  Hepatitis B
dle05163  Human cytomegalovirus infection
dle05164  Influenza A
dle05165  Human papillomavirus infection
dle05166  Human T-cell leukemia virus 1 infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05170  Human immunodeficiency virus 1 infection
dle05171  Coronavirus disease - COVID-19
dle05200  Pathways in cancer
dle05203  Viral carcinogenesis
dle05205  Proteoglycans in cancer
dle05206  MicroRNAs in cancer
dle05207  Chemical carcinogenesis - receptor activation
dle05208  Chemical carcinogenesis - reactive oxygen species
dle05210  Colorectal cancer
dle05211  Renal cell carcinoma
dle05212  Pancreatic cancer
dle05213  Endometrial cancer
dle05214  Glioma
dle05215  Prostate cancer
dle05216  Thyroid cancer
dle05218  Melanoma
dle05219  Bladder cancer
dle05220  Chronic myeloid leukemia
dle05221  Acute myeloid leukemia
dle05223  Non-small cell lung cancer
dle05224  Breast cancer
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
dle05230  Central carbon metabolism in cancer
dle05231  Choline metabolism in cancer
dle05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
dle05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111163022 (MAPK1)
   04012 ErbB signaling pathway
    111163022 (MAPK1)
   04014 Ras signaling pathway
    111163022 (MAPK1)
   04015 Rap1 signaling pathway
    111163022 (MAPK1)
   04350 TGF-beta signaling pathway
    111163022 (MAPK1)
   04370 VEGF signaling pathway
    111163022 (MAPK1)
   04371 Apelin signaling pathway
    111163022 (MAPK1)
   04668 TNF signaling pathway
    111163022 (MAPK1)
   04066 HIF-1 signaling pathway
    111163022 (MAPK1)
   04068 FoxO signaling pathway
    111163022 (MAPK1)
   04072 Phospholipase D signaling pathway
    111163022 (MAPK1)
   04071 Sphingolipid signaling pathway
    111163022 (MAPK1)
   04024 cAMP signaling pathway
    111163022 (MAPK1)
   04022 cGMP-PKG signaling pathway
    111163022 (MAPK1)
   04151 PI3K-Akt signaling pathway
    111163022 (MAPK1)
   04150 mTOR signaling pathway
    111163022 (MAPK1)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    111163022 (MAPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111163022 (MAPK1)
   04148 Efferocytosis
    111163022 (MAPK1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    111163022 (MAPK1)
   04210 Apoptosis
    111163022 (MAPK1)
   04218 Cellular senescence
    111163022 (MAPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111163022 (MAPK1)
   04520 Adherens junction
    111163022 (MAPK1)
   04540 Gap junction
    111163022 (MAPK1)
   04550 Signaling pathways regulating pluripotency of stem cells
    111163022 (MAPK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111163022 (MAPK1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    111163022 (MAPK1)
   04613 Neutrophil extracellular trap formation
    111163022 (MAPK1)
   04620 Toll-like receptor signaling pathway
    111163022 (MAPK1)
   04621 NOD-like receptor signaling pathway
    111163022 (MAPK1)
   04625 C-type lectin receptor signaling pathway
    111163022 (MAPK1)
   04650 Natural killer cell mediated cytotoxicity
    111163022 (MAPK1)
   04660 T cell receptor signaling pathway
    111163022 (MAPK1)
   04658 Th1 and Th2 cell differentiation
    111163022 (MAPK1)
   04659 Th17 cell differentiation
    111163022 (MAPK1)
   04657 IL-17 signaling pathway
    111163022 (MAPK1)
   04662 B cell receptor signaling pathway
    111163022 (MAPK1)
   04664 Fc epsilon RI signaling pathway
    111163022 (MAPK1)
   04666 Fc gamma R-mediated phagocytosis
    111163022 (MAPK1)
   04062 Chemokine signaling pathway
    111163022 (MAPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    111163022 (MAPK1)
   04929 GnRH secretion
    111163022 (MAPK1)
   04912 GnRH signaling pathway
    111163022 (MAPK1)
   04915 Estrogen signaling pathway
    111163022 (MAPK1)
   04914 Progesterone-mediated oocyte maturation
    111163022 (MAPK1)
   04917 Prolactin signaling pathway
    111163022 (MAPK1)
   04921 Oxytocin signaling pathway
    111163022 (MAPK1)
   04926 Relaxin signaling pathway
    111163022 (MAPK1)
   04935 Growth hormone synthesis, secretion and action
    111163022 (MAPK1)
   04919 Thyroid hormone signaling pathway
    111163022 (MAPK1)
   04928 Parathyroid hormone synthesis, secretion and action
    111163022 (MAPK1)
   04916 Melanogenesis
    111163022 (MAPK1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111163022 (MAPK1)
   04270 Vascular smooth muscle contraction
    111163022 (MAPK1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    111163022 (MAPK1)
  09156 Nervous system
   04724 Glutamatergic synapse
    111163022 (MAPK1)
   04725 Cholinergic synapse
    111163022 (MAPK1)
   04726 Serotonergic synapse
    111163022 (MAPK1)
   04720 Long-term potentiation
    111163022 (MAPK1)
   04730 Long-term depression
    111163022 (MAPK1)
   04723 Retrograde endocannabinoid signaling
    111163022 (MAPK1)
   04722 Neurotrophin signaling pathway
    111163022 (MAPK1)
  09158 Development and regeneration
   04360 Axon guidance
    111163022 (MAPK1)
   04380 Osteoclast differentiation
    111163022 (MAPK1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    111163022 (MAPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111163022 (MAPK1)
   05206 MicroRNAs in cancer
    111163022 (MAPK1)
   05205 Proteoglycans in cancer
    111163022 (MAPK1)
   05207 Chemical carcinogenesis - receptor activation
    111163022 (MAPK1)
   05208 Chemical carcinogenesis - reactive oxygen species
    111163022 (MAPK1)
   05203 Viral carcinogenesis
    111163022 (MAPK1)
   05230 Central carbon metabolism in cancer
    111163022 (MAPK1)
   05231 Choline metabolism in cancer
    111163022 (MAPK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111163022 (MAPK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    111163022 (MAPK1)
   05212 Pancreatic cancer
    111163022 (MAPK1)
   05225 Hepatocellular carcinoma
    111163022 (MAPK1)
   05226 Gastric cancer
    111163022 (MAPK1)
   05214 Glioma
    111163022 (MAPK1)
   05216 Thyroid cancer
    111163022 (MAPK1)
   05221 Acute myeloid leukemia
    111163022 (MAPK1)
   05220 Chronic myeloid leukemia
    111163022 (MAPK1)
   05218 Melanoma
    111163022 (MAPK1)
   05211 Renal cell carcinoma
    111163022 (MAPK1)
   05219 Bladder cancer
    111163022 (MAPK1)
   05215 Prostate cancer
    111163022 (MAPK1)
   05213 Endometrial cancer
    111163022 (MAPK1)
   05224 Breast cancer
    111163022 (MAPK1)
   05223 Non-small cell lung cancer
    111163022 (MAPK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111163022 (MAPK1)
   05170 Human immunodeficiency virus 1 infection
    111163022 (MAPK1)
   05161 Hepatitis B
    111163022 (MAPK1)
   05160 Hepatitis C
    111163022 (MAPK1)
   05171 Coronavirus disease - COVID-19
    111163022 (MAPK1)
   05164 Influenza A
    111163022 (MAPK1)
   05163 Human cytomegalovirus infection
    111163022 (MAPK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111163022 (MAPK1)
   05165 Human papillomavirus infection
    111163022 (MAPK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111163022 (MAPK1)
   05135 Yersinia infection
    111163022 (MAPK1)
   05133 Pertussis
    111163022 (MAPK1)
   05152 Tuberculosis
    111163022 (MAPK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111163022 (MAPK1)
   05140 Leishmaniasis
    111163022 (MAPK1)
   05142 Chagas disease
    111163022 (MAPK1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111163022 (MAPK1)
   05020 Prion disease
    111163022 (MAPK1)
   05022 Pathways of neurodegeneration - multiple diseases
    111163022 (MAPK1)
  09165 Substance dependence
   05034 Alcoholism
    111163022 (MAPK1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    111163022 (MAPK1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    111163022 (MAPK1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    111163022 (MAPK1)
   04934 Cushing syndrome
    111163022 (MAPK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111163022 (MAPK1)
   01524 Platinum drug resistance
    111163022 (MAPK1)
   01522 Endocrine resistance
    111163022 (MAPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dle01001]
    111163022 (MAPK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dle03036]
    111163022 (MAPK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dle04147]
    111163022 (MAPK1)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     111163022 (MAPK1)
Protein kinases [BR:dle01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   111163022 (MAPK1)
Chromosome and associated proteins [BR:dle03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     111163022 (MAPK1)
Exosome [BR:dle04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   111163022 (MAPK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH STATB_N Haspin_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 111163022
NCBI-ProteinID: XP_022407111
UniProt: A0A2Y9LEH4
LinkDB
Position
Unknown
AA seq 380 aa
MAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCTYPEETRSNVLLPVRVLSLLR
SAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKD
VYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTT
CDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAE
MLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFP
NADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPK
EKLKELIFEETARFQPGYRS
NT seq 1143 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcgggcgcgggccccgagatggtccgcgggcaggtgttcgacgtg
gggccgcgctacaccaacctctcttacatcggcgagggcgcctacggcatggtgtgcact
tacccagaggagaccagaagtaatgtcttactgcccgtccgtgttctttcattgcttcgc
tctgcttatgataatgtcaacaaagttcgagtagctatcaagaaaatcagcccttttgag
caccagacctactgccagagaaccctgagggagataaaaatcttactgcgcttcagacat
gagaacatcattggaatcaatgatattattcgagcaccaaccattgagcagatgaaagat
gtatatatagtacaggacctcatggaaacagatctctacaagctcttgaagacgcaacac
ctcagcaacgaccatatctgctattttctttaccagatcctcagagggttaaaatatatc
cattcagctaacgtgctgcaccgtgacctcaaaccttccaacctgctgctcaacaccacc
tgcgatctcaagatctgtgactttggcttggcccgtgttgcagatccggaccatgatcac
acagggttcctgacggagtacgttgccacacgttggtacagggctccggaaattatgttg
aattccaagggctacaccaagtccattgatatttggtctgtaggctgcatcctggcagag
atgctctccaacaggcccatctttccggggaagcattacctcgaccagctgaaccacatt
ctgggtattcttggatccccatcccaggaagacctgaattgtataataaatttaaaagct
aggaactatttgctttctcttccgcacaaaaataaggtgccatggaacaggctgttccca
aatgctgactccaaagctctggatttactggacaagatgttgacgttcaaccctcataag
aggattgaggtggaacaggctctggcccacccgtacctggagcagtactacgacccaagt
gacgagcccatcgccgaagcaccattcaagtttgacatggaattggatgacttgcccaag
gaaaagctcaaagaactcatttttgaagagaccgctagattccagccaggatacagatct
taa

DBGET integrated database retrieval system