KEGG   Delphinapterus leucas (beluga whale): 111163867
Entry
111163867         CDS       T05885                                 
Symbol
MRAP
Name
(RefSeq) LOW QUALITY PROTEIN: melanocortin-2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04927  Cortisol synthesis and secretion
dle04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:dle00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    111163867 (MRAP)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111163867 (MRAP)
SSDB
Motif
Pfam: MRAP ABC2_membrane_4
Other DBs
NCBI-GeneID: 111163867
NCBI-ProteinID: XP_022408665
UniProt: A0A2Y9LGH5
LinkDB
Position
Unknown
AA seq 195 aa
MANRTNASTAYDSYEYYLDYLDLIPVDEKKLKASKHSIVIAFWVSLAAFVVFLFLLLLSM
SWPASPQTRKVRTGGGMWNNAQHHPTCPWSLGLNLPFCVWKQPQHHGAPQGTRCLYRARS
RNQVAERRAPSSSCSRRVPPPRPPPPPRAILLSGNWPSMGTRTVPADVRNFKPSEPPLQT
EPLDSRTNNPNQGHC
NT seq 588 nt   +upstreamnt  +downstreamnt
atggccaaccggaccaatgcctctactgcatacgacagctacgaatactacctggactac
ttggacctcattcccgtggatgagaagaagctgaaggccagcaaacattcgatcgtcatc
gccttctgggtgagcctggcagctttcgtggtcttcctgttcctgctgctgctgtccatg
tcctggccagcctccccgcagacgaggaaagtaaggacaggcggaggtatgtggaacaat
gcccagcaccacccaacgtgcccctggagtctcggcctcaacctccccttctgtgtctgg
aagcaaccccagcaccacggggccccccaggggacccgctgcctctaccgagctcggtcg
aggaaccaggtggcagagcgtcgggccccgtccagcagctgcagcaggagagtccctcca
cctcggccccctccaccccccagagccatcctgctctctgggaactggccctcgatgggg
acccgcacggtaccagccgacgtcaggaacttcaagcccagtgagcctcccctgcagaca
gaacctctcgacagtagaaccaacaacccaaaccagggccattgctga

DBGET integrated database retrieval system