Delphinapterus leucas (beluga whale): 111167944 Help Entry 111167944         CDS       T05885                                  Name (RefSeq) histone H3.3-like   KO K11253   histone H3 Organism dle  Delphinapterus leucas (beluga whale) Pathway dle04613   Neutrophil extracellular trap formation dle05034   Alcoholism dle05202   Transcriptional misregulation in cancer dle05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:dle00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     111167944  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     111167944   09163 Immune disease    05322 Systemic lupus erythematosus     111167944   09165 Substance dependence    05034 Alcoholism     111167944  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:dle03036]     111167944   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dle04147]     111167944 Chromosome and associated proteins [BR:dle03036]  Eukaryotic type   Nucleosome assembly factors    Histones     111167944 Exosome [BR:dle04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    111167944 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C CENP-S Motif Other DBs NCBI-GeneID:  111167944 NCBI-ProteinID:  XP_022417053 UniProt:  A0A2Y9MIQ1 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MACTKRAAYKSTRGKAPRKKLATKAACKSVPSTGRLKKPQRYRPGTVALSEIRRCQKSTE LLIHKLPFQHLARKIAQDFKTDLRFQSAATGALQEEREIYLAGLFEDTNLCAIHAKRVTI MPSDIQLARRIRGKHP NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggcttgtacaaagcgggctgcctacaaatcgacccgtggtaaagcaccaaggaagaaa ctggctacaaaagccgcttgcaagagtgtgccctctactggaaggctgaagaaacctcag cgttacaggcctggtaccgtggcactcagtgaaatcagacgttgtcagaagtctactgaa cttctgattcacaaacttcccttccagcatctggcacggaaaattgctcaagacttcaaa acagatctgcgcttccagagtgcagctactggtgctttgcaggaggaacgtgagatctat ctggctgggctttttgaagacaccaacctgtgtgctatccatgccaaacgtgtaacaatt atgccaagcgacatccagctagcacgccgcatacgtggaaaacacccttaa

DBGET integrated database retrieval system