Delphinapterus leucas (beluga whale): 111168450 Help Entry 111168450         CDS       T05885                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism dle  Delphinapterus leucas (beluga whale) Pathway dle04613   Neutrophil extracellular trap formation dle05034   Alcoholism dle05203   Viral carcinogenesis dle05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:dle00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     111168450  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     111168450   09163 Immune disease    05322 Systemic lupus erythematosus     111168450   09165 Substance dependence    05034 Alcoholism     111168450  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:dle03036]     111168450 Chromosome and associated proteins [BR:dle03036]  Eukaryotic type   Nucleosome assembly factors    Histones     111168450 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  111168450 NCBI-ProteinID:  XP_022417870 UniProt:  A0A2Y9MLG6 LinkDB All DBs Position Unknown AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtcgggtcgtgggaagggcgggaagggtctcggaaaggggggcgccaagcgccaccgc aaggtgctgcgcgataatattcagggtatcactaagcccgctattcggcgtttggctagg cgtggtggcgtcaagcgcatctctggcctcatctacgaggagactcgcggggtgctgaag gtgttcctggagaacgtgattcgggacgctgtcacttacaccgagcacgccaagcgcaag accgtcaccgccatggacgtggtctacgcgctcaagcgtcagggacgcaccctttatggc tttggcggctag

DBGET integrated database retrieval system