Delphinapterus leucas (beluga whale): 111168525 Help Entry 111168525         CDS       T05885                                  Name (RefSeq) histone H2B type 1-J-like   KO K11252   histone H2B Organism dle  Delphinapterus leucas (beluga whale) Pathway dle04613   Neutrophil extracellular trap formation dle05034   Alcoholism dle05203   Viral carcinogenesis dle05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:dle00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     111168525  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     111168525   09163 Immune disease    05322 Systemic lupus erythematosus     111168525   09165 Substance dependence    05034 Alcoholism     111168525  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:dle03036]     111168525   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dle04147]     111168525 Chromosome and associated proteins [BR:dle03036]  Eukaryotic type   Nucleosome assembly factors    Histones     111168525 Exosome [BR:dle04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    111168525 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa DUF6246 Motif Other DBs NCBI-GeneID:  111168525 NCBI-ProteinID:  XP_022417985 UniProt:  A0A2Y9M8B6 LinkDB All DBs Position Unknown AA seq 126 aa AA seqDB search MPEAAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSAK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgccggaagcagctaagtctgctcctgctccgaaaaagggctccaagaaggcagtaact aaggcgcagaagaaagatggtaagaagcgcaaacgtagccgcaaggagagttattccatc tatgtgtacaaggtgctgaagcaggtccacccggacaccggtatctcgtctaaggccatg ggcatcatgaactcgtttgtcaacgacatcttcgagcgcatcgcgggcgaggcgtcgcgc ctggcgcattacaacaagcgttcgactatcacgtccagggagatccagacggccgtgcgc ttgctgctgcccggggagctggccaagcacgccgtgtccgagggcaccaaggctgtcacc aaatacaccagcgccaagtaa

DBGET integrated database retrieval system