Delphinapterus leucas (beluga whale): 111168549 Help Entry 111168549         CDS       T05885                                  Name (RefSeq) histone H2B type 1-A   KO K11252   histone H2B Organism dle  Delphinapterus leucas (beluga whale) Pathway dle04613   Neutrophil extracellular trap formation dle05034   Alcoholism dle05203   Viral carcinogenesis dle05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:dle00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     111168549  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     111168549   09163 Immune disease    05322 Systemic lupus erythematosus     111168549   09165 Substance dependence    05034 Alcoholism     111168549  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:dle03036]     111168549   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dle04147]     111168549 Chromosome and associated proteins [BR:dle03036]  Eukaryotic type   Nucleosome assembly factors    Histones     111168549 Exosome [BR:dle04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    111168549 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa ARM_TT21 CvfB_WH Motif Other DBs NCBI-GeneID:  111168549 NCBI-ProteinID:  XP_022418009 UniProt:  A0A2Y9M776 LinkDB All DBs Position Unknown AA seq 127 aa AA seqDB search MPEQASRSIAVSKKGFKKAITKTQKKEERKHKRCRKESYSIYIYKVLKQVHPDTGISSKA MSIMNSFVADVFERIANEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAV AKYTTSL NT seq 384 nt NT seq  +upstreamnt  +downstreamnt atgccagaacaggcttcaagaagtattgctgtttctaagaaaggatttaagaaagccata acaaagactcaaaagaaagaagaaagaaagcacaagagatgtaggaaagagagttattcg atttatatctacaaagtgttgaagcaagtacacccggacaccggtatctcatcgaaagcc atgagtatcatgaattccttcgtcgctgatgttttcgagcgtattgcaaatgaggcttcc cgcttggctcactacaataagcgatcgactattacgtccagggagattcagacggccgtg cgcctgttgctgccaggagagctggctaagcacgctgtgtctgagggcacgaaggctgta gcgaagtacactacctccctgtaa

DBGET integrated database retrieval system