Delphinapterus leucas (beluga whale): 111169721 Help Entry 111169721         CDS       T05885                                  Symbol S100A10 Name (RefSeq) protein S100-A10   KO K17274   protein S100-A10 Organism dle  Delphinapterus leucas (beluga whale) Pathway dle04382   Cornified envelope formation dle05132   Salmonella infection Brite KEGG Orthology (KO) [BR:dle00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     111169721 (S100A10)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     111169721 (S100A10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dle04147]     111169721 (S100A10) Exosome [BR:dle04147]  Exosomal proteins   Exosomal proteins of microglial cells    111169721 (S100A10) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EFhand_Ca_insen EF-hand_8 EF-hand_6 TMP_3 Motif Other DBs NCBI-GeneID:  111169721 NCBI-ProteinID:  XP_022419827 UniProt:  A0A2Y9MLC2 LinkDB All DBs Position Unknown AA seq 96 aa AA seqDB search MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLD QCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKKGKK NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgccctctcaaatggaacatgccatggaaaccatgatgttcacatttcacaagtttgct ggggataaaggctacttaacaaaggaggacctgagagtactcatggaaaaggagttccct ggatttttggaaaatcaaaaagaccctctggctgtggacaaaataatgaaggacctggac cagtgccgagacggcaaagtgggcttccagagcttcttttcactaatcgctgggctcacc atcgcgtgcaatgactattttgtagtacacatgaagaagggaaagaagtag

DBGET integrated database retrieval system