Delphinapterus leucas (beluga whale): 111169748 Help Entry 111169748         CDS       T05885                                  Name (RefSeq) histone H2A type 2-C   KO K11251   histone H2A Organism dle  Delphinapterus leucas (beluga whale) Pathway dle03082   ATP-dependent chromatin remodeling dle04217   Necroptosis dle04613   Neutrophil extracellular trap formation dle05034   Alcoholism dle05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:dle00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     111169748  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     111169748  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     111169748  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     111169748   09165 Substance dependence    05034 Alcoholism     111169748  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:dle03036]     111169748   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dle04147]     111169748 Chromosome and associated proteins [BR:dle03036]  Eukaryotic type   Nucleosome assembly factors    Histones     111169748 Exosome [BR:dle04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    111169748 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Ribosomal_L27A Motif Other DBs NCBI-GeneID:  111169748 NCBI-ProteinID:  XP_022419888 UniProt:  A0A2Y9MRX4 LinkDB All DBs Position Unknown AA seq 129 aa AA seqDB search MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK TESHKAKSK NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgtctggccgcggaaagcaaggaggcaaggcccgtgccaaagccaagtcgcgctcgtcc cgcgcaggtctgcagttcccggtggggcgagtgcaccgtctgctacgcaaaggcaactac gccgagcgggtgggggccggcgcgcccgtctacatggcggcagttctcgagtacctgacc gccgaaattctggagctggcgggcaacgcggcccgagacaacaagaagacgcgcatcatc cctcgtcacctgcagctggccatccgcaacgacgaggaactgaataagctgttgggcaaa gtcaccatcgcccagggtggcgttttgcccaatatccaggccgttctattaccaaagaaa actgaaagccacaaagccaaaagcaaataa

DBGET integrated database retrieval system