Delphinapterus leucas (beluga whale): 111169761 Help Entry 111169761         CDS       T05885                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism dle  Delphinapterus leucas (beluga whale) Pathway dle04613   Neutrophil extracellular trap formation dle05034   Alcoholism dle05203   Viral carcinogenesis dle05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:dle00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     111169761  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     111169761   09163 Immune disease    05322 Systemic lupus erythematosus     111169761   09165 Substance dependence    05034 Alcoholism     111169761  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:dle03036]     111169761 Chromosome and associated proteins [BR:dle03036]  Eukaryotic type   Nucleosome assembly factors    Histones     111169761 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  111169761 NCBI-ProteinID:  XP_022419918 UniProt:  A0A2Y9MLG6 LinkDB All DBs Position Unknown AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctggaagagggaagggcggcaaaggcttgggcaagggtggcgctaagcgccaccgc aaggttttgagagataacatccaaggcatcaccaagcccgccatccggcgtcttgctcgg cgcgggggtgtcaagcgcatctccggcctcatttacgaagagacccgaggtgtgttgaag gtgttcctggagaatgtcattcgggacgcggtcacctacacggagcacgccaagcgcaag acggtcactgccatggacgtggtgtacgcgctcaaacggcagggacgcacactgtatggc ttcggaggttaa

DBGET integrated database retrieval system