Delphinapterus leucas (beluga whale): 111169971 Help Entry 111169971         CDS       T05885                                  Symbol BRK1 Name (RefSeq) protein BRICK1   KO K05752   chromosome 3 open reading frame 10 Organism dle  Delphinapterus leucas (beluga whale) Pathway dle04810   Regulation of actin cytoskeleton dle05132   Salmonella infection Brite KEGG Orthology (KO) [BR:dle00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     111169971 (BRK1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     111169971 (BRK1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CCDC53 Hydro_N_hd DUF7310 SPX Matrilin_ccoil MerR-DNA-bind DUF5617 LXG Motif Other DBs NCBI-GeneID:  111169971 NCBI-ProteinID:  XP_022420408 UniProt:  A0A2Y9MTE8 LinkDB All DBs Position Unknown AA seq 75 aa AA seqDB search MAGQEDPVQREIHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERR IEYIEARVTKGETLT NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggcggggcaagaggatccggtgcagcgggagattcaccaggactgggcgaaccgggag tacattgaggtcatcaccagcagcatcaagaaaatcgcagactttctcaactcgttcgat atgtcttgtcgttcaagactcgcaacactaaacgagaaattgacagctcttgagcggaga atagagtacattgaagcaagggtgacaaaaggtgagaccctcacctag

DBGET integrated database retrieval system