Delphinapterus leucas (beluga whale): 111170127 Help Entry 111170127         CDS       T05885                                  Name (RefSeq) calmodulin-like   KO K02183   calmodulin Organism dle  Delphinapterus leucas (beluga whale) Pathway dle04014   Ras signaling pathway dle04015   Rap1 signaling pathway dle04020   Calcium signaling pathway dle04022   cGMP-PKG signaling pathway dle04024   cAMP signaling pathway dle04070   Phosphatidylinositol signaling system dle04114   Oocyte meiosis dle04218   Cellular senescence dle04261   Adrenergic signaling in cardiomyocytes dle04270   Vascular smooth muscle contraction dle04371   Apelin signaling pathway dle04625   C-type lectin receptor signaling pathway dle04713   Circadian entrainment dle04720   Long-term potentiation dle04722   Neurotrophin signaling pathway dle04728   Dopaminergic synapse dle04740   Olfactory transduction dle04744   Phototransduction dle04750   Inflammatory mediator regulation of TRP channels dle04910   Insulin signaling pathway dle04912   GnRH signaling pathway dle04915   Estrogen signaling pathway dle04916   Melanogenesis dle04921   Oxytocin signaling pathway dle04922   Glucagon signaling pathway dle04924   Renin secretion dle04925   Aldosterone synthesis and secretion dle04970   Salivary secretion dle04971   Gastric acid secretion dle05010   Alzheimer disease dle05012   Parkinson disease dle05022   Pathways of neurodegeneration - multiple diseases dle05031   Amphetamine addiction dle05034   Alcoholism dle05133   Pertussis dle05152   Tuberculosis dle05163   Human cytomegalovirus infection dle05167   Kaposi sarcoma-associated herpesvirus infection dle05170   Human immunodeficiency virus 1 infection dle05200   Pathways in cancer dle05214   Glioma dle05417   Lipid and atherosclerosis dle05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:dle00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     111170127    04015 Rap1 signaling pathway     111170127    04371 Apelin signaling pathway     111170127    04020 Calcium signaling pathway     111170127    04070 Phosphatidylinositol signaling system     111170127    04024 cAMP signaling pathway     111170127    04022 cGMP-PKG signaling pathway     111170127  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     111170127    04218 Cellular senescence     111170127  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     111170127   09152 Endocrine system    04910 Insulin signaling pathway     111170127    04922 Glucagon signaling pathway     111170127    04912 GnRH signaling pathway     111170127    04915 Estrogen signaling pathway     111170127    04921 Oxytocin signaling pathway     111170127    04916 Melanogenesis     111170127    04924 Renin secretion     111170127    04925 Aldosterone synthesis and secretion     111170127   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     111170127    04270 Vascular smooth muscle contraction     111170127   09154 Digestive system    04970 Salivary secretion     111170127    04971 Gastric acid secretion     111170127   09156 Nervous system    04728 Dopaminergic synapse     111170127    04720 Long-term potentiation     111170127    04722 Neurotrophin signaling pathway     111170127   09157 Sensory system    04744 Phototransduction     111170127    04740 Olfactory transduction     111170127    04750 Inflammatory mediator regulation of TRP channels     111170127   09159 Environmental adaptation    04713 Circadian entrainment     111170127  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     111170127   09162 Cancer: specific types    05214 Glioma     111170127   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     111170127    05163 Human cytomegalovirus infection     111170127    05167 Kaposi sarcoma-associated herpesvirus infection     111170127   09171 Infectious disease: bacterial    05133 Pertussis     111170127    05152 Tuberculosis     111170127   09164 Neurodegenerative disease    05010 Alzheimer disease     111170127    05012 Parkinson disease     111170127    05022 Pathways of neurodegeneration - multiple diseases     111170127   09165 Substance dependence    05031 Amphetamine addiction     111170127    05034 Alcoholism     111170127   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     111170127    05418 Fluid shear stress and atherosclerosis     111170127  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:dle01009]     111170127   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dle04131]     111170127    03036 Chromosome and associated proteins [BR:dle03036]     111170127   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dle04147]     111170127 Protein phosphatases and associated proteins [BR:dle01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      111170127 Membrane trafficking [BR:dle04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     111170127 Chromosome and associated proteins [BR:dle03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      111170127 Exosome [BR:dle04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    111170127 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 SPARC_Ca_bdg AIF-1 EF-hand_9 Dockerin_1 EH EF_EFCAB10_C RPN13_C WHD_MCM8 EAD7 Motif Other DBs NCBI-GeneID:  111170127 NCBI-ProteinID:  XP_030616518 UniProt:  A0A7F8K8Q9 LinkDB All DBs Position Unknown AA seq 147 aa AA seqDB search MAEQLSKEQVAEFMEAFHRFDKDKDNAINTQELGAVMQELGLNPSEAALKGFIARDDADG DGVISPQEFLAVIAKGVQARARADDLRTAFHAFDLDGDGHISVDELKQAMAQLEVSQEEL DIMIREADVDRDGQVSYEEFVHVLMLK NT seq 444 nt NT seq  +upstreamnt  +downstreamnt atggctgagcagctgtccaaagagcaggtggccgagttcatggaggccttccatagattc gacaaggacaaagacaatgccatcaacacccaggagctgggcgccgtgatgcaggagctg ggcctgaacccgtcggaggccgcgctgaagggattcatcgccagggacgatgcggacggg gatggcgtcatcagcccccaggagttcctggcagtgatagccaagggggttcaggcccgg gccagagcggatgacctgaggacagccttccacgccttcgacctggatggcgacggccac atcagcgtggatgagctcaagcaggccatggcccagctggaggtgtcccaggaggagttg gacatcatgatccgggaagctgacgtggaccgggacgggcaggtgagctacgaggagttc gtgcacgtcctcatgctgaagtga

DBGET integrated database retrieval system