Delphinapterus leucas (beluga whale): 111170340 Help Entry 111170340         CDS       T05885                                  Symbol HRAS Name (RefSeq) GTPase HRas isoform X1   KO K02833   GTPase HRas Organism dle  Delphinapterus leucas (beluga whale) Pathway dle01521   EGFR tyrosine kinase inhibitor resistance dle01522   Endocrine resistance dle04010   MAPK signaling pathway dle04012   ErbB signaling pathway dle04014   Ras signaling pathway dle04015   Rap1 signaling pathway dle04062   Chemokine signaling pathway dle04068   FoxO signaling pathway dle04071   Sphingolipid signaling pathway dle04072   Phospholipase D signaling pathway dle04137   Mitophagy - animal dle04140   Autophagy - animal dle04144   Endocytosis dle04150   mTOR signaling pathway dle04151   PI3K-Akt signaling pathway dle04210   Apoptosis dle04211   Longevity regulating pathway dle04213   Longevity regulating pathway - multiple species dle04218   Cellular senescence dle04360   Axon guidance dle04370   VEGF signaling pathway dle04371   Apelin signaling pathway dle04510   Focal adhesion dle04540   Gap junction dle04550   Signaling pathways regulating pluripotency of stem cells dle04625   C-type lectin receptor signaling pathway dle04630   JAK-STAT signaling pathway dle04650   Natural killer cell mediated cytotoxicity dle04660   T cell receptor signaling pathway dle04662   B cell receptor signaling pathway dle04664   Fc epsilon RI signaling pathway dle04714   Thermogenesis dle04720   Long-term potentiation dle04722   Neurotrophin signaling pathway dle04725   Cholinergic synapse dle04726   Serotonergic synapse dle04730   Long-term depression dle04810   Regulation of actin cytoskeleton dle04910   Insulin signaling pathway dle04912   GnRH signaling pathway dle04915   Estrogen signaling pathway dle04916   Melanogenesis dle04917   Prolactin signaling pathway dle04919   Thyroid hormone signaling pathway dle04921   Oxytocin signaling pathway dle04926   Relaxin signaling pathway dle04929   GnRH secretion dle04933   AGE-RAGE signaling pathway in diabetic complications dle04935   Growth hormone synthesis, secretion and action dle05010   Alzheimer disease dle05022   Pathways of neurodegeneration - multiple diseases dle05034   Alcoholism dle05132   Salmonella infection dle05160   Hepatitis C dle05161   Hepatitis B dle05163   Human cytomegalovirus infection dle05165   Human papillomavirus infection dle05166   Human T-cell leukemia virus 1 infection dle05167   Kaposi sarcoma-associated herpesvirus infection dle05170   Human immunodeficiency virus 1 infection dle05200   Pathways in cancer dle05203   Viral carcinogenesis dle05205   Proteoglycans in cancer dle05206   MicroRNAs in cancer dle05207   Chemical carcinogenesis - receptor activation dle05208   Chemical carcinogenesis - reactive oxygen species dle05210   Colorectal cancer dle05211   Renal cell carcinoma dle05213   Endometrial cancer dle05214   Glioma dle05215   Prostate cancer dle05216   Thyroid cancer dle05218   Melanoma dle05219   Bladder cancer dle05220   Chronic myeloid leukemia dle05221   Acute myeloid leukemia dle05223   Non-small cell lung cancer dle05224   Breast cancer dle05225   Hepatocellular carcinoma dle05226   Gastric cancer dle05230   Central carbon metabolism in cancer dle05231   Choline metabolism in cancer dle05235   PD-L1 expression and PD-1 checkpoint pathway in cancer dle05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:dle00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     111170340 (HRAS)    04012 ErbB signaling pathway     111170340 (HRAS)    04014 Ras signaling pathway     111170340 (HRAS)    04015 Rap1 signaling pathway     111170340 (HRAS)    04370 VEGF signaling pathway     111170340 (HRAS)    04371 Apelin signaling pathway     111170340 (HRAS)    04630 JAK-STAT signaling pathway     111170340 (HRAS)    04068 FoxO signaling pathway     111170340 (HRAS)    04072 Phospholipase D signaling pathway     111170340 (HRAS)    04071 Sphingolipid signaling pathway     111170340 (HRAS)    04151 PI3K-Akt signaling pathway     111170340 (HRAS)    04150 mTOR signaling pathway     111170340 (HRAS)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     111170340 (HRAS)    04140 Autophagy - animal     111170340 (HRAS)    04137 Mitophagy - animal     111170340 (HRAS)   09143 Cell growth and death    04210 Apoptosis     111170340 (HRAS)    04218 Cellular senescence     111170340 (HRAS)   09144 Cellular community - eukaryotes    04510 Focal adhesion     111170340 (HRAS)    04540 Gap junction     111170340 (HRAS)    04550 Signaling pathways regulating pluripotency of stem cells     111170340 (HRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     111170340 (HRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     111170340 (HRAS)    04650 Natural killer cell mediated cytotoxicity     111170340 (HRAS)    04660 T cell receptor signaling pathway     111170340 (HRAS)    04662 B cell receptor signaling pathway     111170340 (HRAS)    04664 Fc epsilon RI signaling pathway     111170340 (HRAS)    04062 Chemokine signaling pathway     111170340 (HRAS)   09152 Endocrine system    04910 Insulin signaling pathway     111170340 (HRAS)    04929 GnRH secretion     111170340 (HRAS)    04912 GnRH signaling pathway     111170340 (HRAS)    04915 Estrogen signaling pathway     111170340 (HRAS)    04917 Prolactin signaling pathway     111170340 (HRAS)    04921 Oxytocin signaling pathway     111170340 (HRAS)    04926 Relaxin signaling pathway     111170340 (HRAS)    04935 Growth hormone synthesis, secretion and action     111170340 (HRAS)    04919 Thyroid hormone signaling pathway     111170340 (HRAS)    04916 Melanogenesis     111170340 (HRAS)   09156 Nervous system    04725 Cholinergic synapse     111170340 (HRAS)    04726 Serotonergic synapse     111170340 (HRAS)    04720 Long-term potentiation     111170340 (HRAS)    04730 Long-term depression     111170340 (HRAS)    04722 Neurotrophin signaling pathway     111170340 (HRAS)   09158 Development and regeneration    04360 Axon guidance     111170340 (HRAS)   09149 Aging    04211 Longevity regulating pathway     111170340 (HRAS)    04213 Longevity regulating pathway - multiple species     111170340 (HRAS)   09159 Environmental adaptation    04714 Thermogenesis     111170340 (HRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     111170340 (HRAS)    05206 MicroRNAs in cancer     111170340 (HRAS)    05205 Proteoglycans in cancer     111170340 (HRAS)    05207 Chemical carcinogenesis - receptor activation     111170340 (HRAS)    05208 Chemical carcinogenesis - reactive oxygen species     111170340 (HRAS)    05203 Viral carcinogenesis     111170340 (HRAS)    05230 Central carbon metabolism in cancer     111170340 (HRAS)    05231 Choline metabolism in cancer     111170340 (HRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     111170340 (HRAS)   09162 Cancer: specific types    05210 Colorectal cancer     111170340 (HRAS)    05225 Hepatocellular carcinoma     111170340 (HRAS)    05226 Gastric cancer     111170340 (HRAS)    05214 Glioma     111170340 (HRAS)    05216 Thyroid cancer     111170340 (HRAS)    05221 Acute myeloid leukemia     111170340 (HRAS)    05220 Chronic myeloid leukemia     111170340 (HRAS)    05218 Melanoma     111170340 (HRAS)    05211 Renal cell carcinoma     111170340 (HRAS)    05219 Bladder cancer     111170340 (HRAS)    05215 Prostate cancer     111170340 (HRAS)    05213 Endometrial cancer     111170340 (HRAS)    05224 Breast cancer     111170340 (HRAS)    05223 Non-small cell lung cancer     111170340 (HRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     111170340 (HRAS)    05170 Human immunodeficiency virus 1 infection     111170340 (HRAS)    05161 Hepatitis B     111170340 (HRAS)    05160 Hepatitis C     111170340 (HRAS)    05163 Human cytomegalovirus infection     111170340 (HRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     111170340 (HRAS)    05165 Human papillomavirus infection     111170340 (HRAS)   09171 Infectious disease: bacterial    05132 Salmonella infection     111170340 (HRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     111170340 (HRAS)    05022 Pathways of neurodegeneration - multiple diseases     111170340 (HRAS)   09165 Substance dependence    05034 Alcoholism     111170340 (HRAS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     111170340 (HRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     111170340 (HRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     111170340 (HRAS)    01522 Endocrine resistance     111170340 (HRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dle04131]     111170340 (HRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dle04147]     111170340 (HRAS)    04031 GTP-binding proteins [BR:dle04031]     111170340 (HRAS) Membrane trafficking [BR:dle04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     111170340 (HRAS)  Endocytosis   Macropinocytosis    Ras GTPases     111170340 (HRAS) Exosome [BR:dle04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    111170340 (HRAS)   Exosomal proteins of colorectal cancer cells    111170340 (HRAS) GTP-binding proteins [BR:dle04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     111170340 (HRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin AAA_22 Ldh_1_N AAA_16 Motif Other DBs NCBI-GeneID:  111170340 NCBI-ProteinID:  XP_022421119 UniProt:  A0A2Y9MGR2 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNAKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL AARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKARKLSPPDEGGPG CLSCRCLLS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacggagtataagctcgtggtggtgggcgctggaggcgtggggaagagcgccctgacc atccagctcatccagaaccactttgtggatgagtacgaccccaccatagaggactcctac cggaagcaagtggtcatcgatggggagacgtgcctgttggacatcctggacacggcgggc caggaggagtacagcgccatgcgggaccagtacatgcgcaccggggagggcttcctttgt gtgtttgccatcaacaacgccaagtccttcgaggacatccaccagtacagggagcagatc aaacgggtgaaggactcggacgacgtgcccatggtgctggtggggaacaagtgtgacctg gccgcgcgcaccgtggagtctcggcaggcccaggacctcgcccgcagctacggcatcccc tacatcgagacgtcggccaagacgcgccagggcgtggaggatgccttctacacgctggtg cgcgagatccggcagcacaaggcgcgcaagctgagcccgcctgacgagggtggcccgggc tgcctgagctgcaggtgcctgctctcctga

DBGET integrated database retrieval system