Delphinapterus leucas (beluga whale): 111171120 Help Entry 111171120         CDS       T05885                                  Name (RefSeq) late histone H2B.L4-like   KO K11252   histone H2B Organism dle  Delphinapterus leucas (beluga whale) Pathway dle04613   Neutrophil extracellular trap formation dle05034   Alcoholism dle05203   Viral carcinogenesis dle05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:dle00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     111171120  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     111171120   09163 Immune disease    05322 Systemic lupus erythematosus     111171120   09165 Substance dependence    05034 Alcoholism     111171120  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:dle03036]     111171120   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dle04147]     111171120 Chromosome and associated proteins [BR:dle03036]  Eukaryotic type   Nucleosome assembly factors    Histones     111171120 Exosome [BR:dle04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    111171120 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TAF NFACT-R_2 TFIID_20kDa Motif Other DBs NCBI-GeneID:  111171120 NCBI-ProteinID:  XP_022422466 UniProt:  A0A2Y9MNB9 LinkDB All DBs Position Unknown AA seq 135 aa AA seqDB search MHEPSSEMSEESLATKEAESSEAEPKNPKQKTLKRHRRRHSDGFDSFATYFPRVLKRVHE GLSLSQEAVNVMDSFVKDIFERIANEAARLVRSSKRSTLSSREIQTSVRLLLPGEVGKHA VSNASKAVIRYTTGK NT seq 408 nt NT seq  +upstreamnt  +downstreamnt atgcatgagccttcgtctgagatgtctgaagaaagcctggccaccaaggaagccgagtcc tccgaagctgagccgaagaacccgaagcagaagacactgaagcgccaccgccgccgccac tctgatggcttcgacagctttgccacctatttccccagggtgctgaagcgggtccacgag ggcctgagcctctcgcaggaggccgtgaatgtcatggattcgttcgtcaaggacatcttt gagcgaatcgccaacgaggcggcacgccttgtccgctccagcaagcgctccaccctcagc tccagagagatccagacctccgtgcgcttgctgctgcctggggaggtgggcaagcacgcc gtgtccaacgccagcaaggccgtcatcagatacaccactggcaaataa

DBGET integrated database retrieval system