Delphinapterus leucas (beluga whale): 111172108 Help Entry 111172108         CDS       T05885                                  Symbol NPPC Name (RefSeq) C-type natriuretic peptide   KO K12336   natriuretic peptide C Organism dle  Delphinapterus leucas (beluga whale) Pathway dle04022   cGMP-PKG signaling pathway dle04081   Hormone signaling dle04270   Vascular smooth muscle contraction dle05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:dle00001]  09130 Environmental Information Processing   09132 Signal transduction    04022 cGMP-PKG signaling pathway     111172108 (NPPC)   09133 Signaling molecules and interaction    04081 Hormone signaling     111172108 (NPPC)  09150 Organismal Systems   09153 Circulatory system    04270 Vascular smooth muscle contraction     111172108 (NPPC)  09160 Human Diseases   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     111172108 (NPPC)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:dle04052]     111172108 (NPPC) Cytokines and neuropeptides [BR:dle04052]  Neuropeptides   Unclassified    111172108 (NPPC) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ANP Motif Other DBs NCBI-GeneID:  111172108 NCBI-ProteinID:  XP_022424031 UniProt:  A0A2Y9MSW0 LinkDB All DBs Position Unknown AA seq 126 aa AA seqDB search MHLSQLLACALLLALLSLRPSEAKPGAPPKVPRTPPGEEVAEPQAAGGGQKKGDKTPGGG GANLKGDRSRLLRDLRVDTKSRAAWARLLQEHPNARKYKGGNKKGLSKGCFGLKLDRIGS MSGLGC NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcacctctcccagctgctggcctgcgccctgctgctcgcgctactctcgctccggccc tccgaagccaagcccggggcgccgccgaaggtcccgcgcactccgccaggggaggaggtg gccgagccccaggctgcgggaggaggtcagaagaagggcgacaagactcccgggggcggc ggcgccaatctcaagggcgaccggtcgcgactgctccgggacttgcgcgtggacaccaag tctcgggcggcgtgggcccgtcttctgcaagagcaccccaacgcgcggaaatacaaggga ggcaacaagaagggtttgtccaagggctgcttcggcctcaagctggacaggatcggctcc atgagcggcctgggatgttaa

DBGET integrated database retrieval system