Delphinapterus leucas (beluga whale): 111173709 Help Entry 111173709         CDS       T05885                                  Symbol IL23A Name (RefSeq) interleukin-23 subunit alpha   KO K05426   interleukin 23 subunit alpha Organism dle  Delphinapterus leucas (beluga whale) Pathway dle04060   Cytokine-cytokine receptor interaction dle04625   C-type lectin receptor signaling pathway dle04630   JAK-STAT signaling pathway dle04659   Th17 cell differentiation dle05133   Pertussis dle05152   Tuberculosis dle05200   Pathways in cancer dle05321   Inflammatory bowel disease dle05323   Rheumatoid arthritis Brite KEGG Orthology (KO) [BR:dle00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     111173709 (IL23A)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     111173709 (IL23A)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     111173709 (IL23A)    04659 Th17 cell differentiation     111173709 (IL23A)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     111173709 (IL23A)   09171 Infectious disease: bacterial    05133 Pertussis     111173709 (IL23A)    05152 Tuberculosis     111173709 (IL23A)   09163 Immune disease    05323 Rheumatoid arthritis     111173709 (IL23A)    05321 Inflammatory bowel disease     111173709 (IL23A)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:dle04052]     111173709 (IL23A) Cytokines and neuropeptides [BR:dle04052]  Cytokines   Interleukins    111173709 (IL23A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL23 Motif Other DBs NCBI-GeneID:  111173709 NCBI-ProteinID:  XP_030618914 UniProt:  A0A7F8KBW1 LinkDB All DBs Position Unknown AA seq 107 aa AA seqDB search FFSPQSCLQRIHQGLVFYEKLLGSDIFTGEPSLVLDGPVGQLHASLLGLRELLQPEGHHW EIEQTPSPSPSQPWQRLLLRLKILRSLQAFVAVAARVFAHGAATLSP NT seq 324 nt NT seq  +upstreamnt  +downstreamnt ttcttttctccccagtcctgcttgcaaaggatccaccaaggcttggttttttacgagaag ctgctgggctcagatattttcacaggggagccttctctagtcctcgatggccctgtgggc cagcttcatgcctccctactgggcctcagggaactcttgcagcccgagggtcaccactgg gagattgagcagactccaagtcccagtcccagccagccgtggcagcgcctccttctccgc ctcaagatccttcgcagcctccaggcctttgtggctgtagctgccagggtctttgcccat ggagcagcaactctgagcccctaa

DBGET integrated database retrieval system