Delphinapterus leucas (beluga whale): 111174517 Help Entry 111174517         CDS       T05885                                  Symbol IL12A Name (RefSeq) interleukin-12 subunit alpha   KO K05406   interleukin 12A Organism dle  Delphinapterus leucas (beluga whale) Pathway dle04060   Cytokine-cytokine receptor interaction dle04620   Toll-like receptor signaling pathway dle04622   RIG-I-like receptor signaling pathway dle04625   C-type lectin receptor signaling pathway dle04630   JAK-STAT signaling pathway dle04658   Th1 and Th2 cell differentiation dle04936   Alcoholic liver disease dle04940   Type I diabetes mellitus dle05133   Pertussis dle05134   Legionellosis dle05140   Leishmaniasis dle05142   Chagas disease dle05143   African trypanosomiasis dle05144   Malaria dle05145   Toxoplasmosis dle05146   Amoebiasis dle05152   Tuberculosis dle05162   Measles dle05164   Influenza A dle05168   Herpes simplex virus 1 infection dle05171   Coronavirus disease - COVID-19 dle05200   Pathways in cancer dle05321   Inflammatory bowel disease dle05330   Allograft rejection dle05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:dle00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     111174517 (IL12A)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     111174517 (IL12A)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     111174517 (IL12A)    04622 RIG-I-like receptor signaling pathway     111174517 (IL12A)    04625 C-type lectin receptor signaling pathway     111174517 (IL12A)    04658 Th1 and Th2 cell differentiation     111174517 (IL12A)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     111174517 (IL12A)   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     111174517 (IL12A)    05164 Influenza A     111174517 (IL12A)    05162 Measles     111174517 (IL12A)    05168 Herpes simplex virus 1 infection     111174517 (IL12A)   09171 Infectious disease: bacterial    05133 Pertussis     111174517 (IL12A)    05134 Legionellosis     111174517 (IL12A)    05152 Tuberculosis     111174517 (IL12A)   09174 Infectious disease: parasitic    05146 Amoebiasis     111174517 (IL12A)    05144 Malaria     111174517 (IL12A)    05145 Toxoplasmosis     111174517 (IL12A)    05140 Leishmaniasis     111174517 (IL12A)    05142 Chagas disease     111174517 (IL12A)    05143 African trypanosomiasis     111174517 (IL12A)   09163 Immune disease    05321 Inflammatory bowel disease     111174517 (IL12A)    05330 Allograft rejection     111174517 (IL12A)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     111174517 (IL12A)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     111174517 (IL12A)    04936 Alcoholic liver disease     111174517 (IL12A)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:dle04052]     111174517 (IL12A)    00536 Glycosaminoglycan binding proteins [BR:dle00536]     111174517 (IL12A) Cytokines and neuropeptides [BR:dle04052]  Cytokines   Interleukins    111174517 (IL12A) Glycosaminoglycan binding proteins [BR:dle00536]  Heparan sulfate / Heparin   Cytokines    111174517 (IL12A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL12 Motif Other DBs NCBI-GeneID:  111174517 NCBI-ProteinID:  XP_022429128 UniProt:  A0A2Y9NIK9 LinkDB All DBs Position Unknown AA seq 222 aa AA seqDB search MCPPRTLLLVATLVLLHHLNHFSLARSLPATTAGPGMFQCLNHSQNLLRAVSNTLEKARQ TLEFYSCTSEEIDHEDITKDRTSTVEACLPLELATNESCLASRETSLITNGSCLASRRSS FMTTLCLSSIYEDLRMYHMEFQAMNAKLLMDPKRQIFVDQNMLAAVAELMQALNSHSKIV SQKPSLGELDFYKTKVKLCILLHAFRIRVVTIDRMMSYLSSS NT seq 669 nt NT seq  +upstreamnt  +downstreamnt atgtgcccgcctcgcaccctcctccttgtggccaccctggtcctcctccaccacctgaac cactttagtttggccaggagcctccccgccaccacagcgggccccggaatgttccagtgc ctcaaccactcccaaaacctgctgagagccgtcagcaacacccttgagaaggccagacaa accctagaattttactcctgcacttctgaagagattgatcacgaagatatcaccaaagat agaaccagcacagtggaggcctgcttaccactggaattagccacgaatgagagttgcctg gcttccagagagacctctttaataactaatgggagttgcctggcttccagaaggagctct tttatgacgaccctgtgccttagcagtatctatgaggacttgaggatgtaccacatggag ttccaggccatgaacgcaaagctcctgatggatcctaagaggcagatctttgtggatcag aacatgctggcggctgttgctgagctgatgcaggccctgaattcccacagcaagattgtg tcacagaaaccctccctgggagaactggatttttataagactaaagtcaagctctgcata cttcttcatgccttcagaattcgtgtggtgaccatcgacagaatgatgagctatctgagt tcttcctaa

DBGET integrated database retrieval system