Delphinapterus leucas (beluga whale): 111174908 Help Entry 111174908         CDS       T05885                                  Symbol DPY30 Name (RefSeq) protein dpy-30 homolog   KO K14965   protein dpy-30 Organism dle  Delphinapterus leucas (beluga whale) Brite KEGG Orthology (KO) [BR:dle00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:dle03036]     111174908 (DPY30) Chromosome and associated proteins [BR:dle03036]  Eukaryotic type   Histone modification proteins    HMT complexes     COMPASS/SET1 complex      111174908 (DPY30)     MLL-HCF complex      111174908 (DPY30)     MLL3/MLL4 complex      111174908 (DPY30) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dpy-30 RIIa Motif Other DBs NCBI-GeneID:  111174908 NCBI-ProteinID:  XP_022429843 UniProt:  A0A2Y9N562 LinkDB All DBs Position Unknown AA seq 99 aa AA seqDB search MEPEQMLEGQTQVAENPHSEYGLTDNVERIVENEKINAEKSSKQKVDLQSLPTRAYLDQT VVPILLQGLAVLAKERPPNPIEFLASYLLKNKAQFEDRN NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atggaaccagagcagatgctggagggacagacgcaggttgcagaaaatccccactctgag tacggtctcacagacaacgtcgagaggatagtagaaaatgagaaaattaatgcagaaaag tcatcaaaacagaaagtggatctccagtctttgccaactcgtgcctatctggatcagaca gttgtgcctatcttattacaaggacttgctgtgcttgcaaaggaaagaccaccaaatccc attgaatttctagcatcctatcttttaaaaaacaaggcacagtttgaagatcgaaactga

DBGET integrated database retrieval system