Delphinapterus leucas (beluga whale): 111175202 Help Entry 111175202         CDS       T05885                                  Symbol HMGB1 Name (RefSeq) high mobility group protein B1   KO K10802   high mobility group protein B1 Organism dle  Delphinapterus leucas (beluga whale) Pathway dle03410   Base excision repair dle04140   Autophagy - animal dle04217   Necroptosis dle04613   Neutrophil extracellular trap formation Brite KEGG Orthology (KO) [BR:dle00001]  09120 Genetic Information Processing   09124 Replication and repair    03410 Base excision repair     111175202 (HMGB1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     111175202 (HMGB1)   09143 Cell growth and death    04217 Necroptosis     111175202 (HMGB1)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     111175202 (HMGB1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:dle03036]     111175202 (HMGB1)    03400 DNA repair and recombination proteins [BR:dle03400]     111175202 (HMGB1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dle04147]     111175202 (HMGB1) Chromosome and associated proteins [BR:dle03036]  Eukaryotic type   Nucleosome assembly factors    HMG (high mobility group) proteins     111175202 (HMGB1) DNA repair and recombination proteins [BR:dle03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Other BER factors      111175202 (HMGB1)    MMR (mismatch excision repair)     Other MMR factors      111175202 (HMGB1) Exosome [BR:dle04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    111175202 (HMGB1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  HMG_box_2 HMG_box HMG_WDHD1 NOA36 HMG_box_5 Nop14 Motif Other DBs NCBI-GeneID:  111175202 NCBI-ProteinID:  XP_022430292 UniProt:  A0A2Y9NLU9 LinkDB All DBs Position Unknown AA seq 215 aa AA seqDB search MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKF EDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGL SIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEK SKKKKEEEEDEEDEEDEEEEEDEEDEEEEEDDDDE NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgggcaaaggagatcctaagaagccgagaggcaaaatgtcatcatatgcattctttgtg caaacttgccgggaggagcacaagaagaagcacccagatgcttctgtcaacttctcagag ttttctaagaagtgctcagagaggtggaagaccatgtctgctaaagagaaaggaaagttt gaagacatggcaaaggcggacaaggcccgttatgaaagagaaatgaaaacttatatccct cctaaaggggagacaaaaaagaagttcaaggatcccaatgcacccaagaggcctccttcg gcctttttcttgttttgttctgagtatcgtccaaaaatcaaaggagaacatcctggccta tccattggtgatgttgcaaagaaactgggagagatgtggaataacactgctgcagatgac aagcagccttatgagaagaaggctgctaaactgaaggaaaagtacgaaaaggatattgct gcataccgagctaaagggaagcctgatgcagcaaaaaagggagtcgtcaaggctgaaaaa agcaagaaaaagaaggaagaggaggaagatgaggaagatgaagaggatgaggaggaggag gaggatgaagaggatgaagaggaagaagaagatgatgatgatgaataa

DBGET integrated database retrieval system