Delphinapterus leucas (beluga whale): 111175442 Help Entry 111175442         CDS       T05885                                  Name (RefSeq) 14-3-3 protein gamma-like   KO K16198   14-3-3 protein gamma/eta Organism dle  Delphinapterus leucas (beluga whale) Pathway dle04110   Cell cycle dle04114   Oocyte meiosis dle04151   PI3K-Akt signaling pathway dle04390   Hippo signaling pathway dle05160   Hepatitis C dle05203   Viral carcinogenesis Brite KEGG Orthology (KO) [BR:dle00001]  09130 Environmental Information Processing   09132 Signal transduction    04390 Hippo signaling pathway     111175442    04151 PI3K-Akt signaling pathway     111175442  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     111175442    04114 Oocyte meiosis     111175442  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     111175442   09172 Infectious disease: viral    05160 Hepatitis C     111175442  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:dle01009]     111175442   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:dle03400]     111175442   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dle04147]     111175442 Protein phosphatases and associated proteins [BR:dle01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      111175442 DNA repair and recombination proteins [BR:dle03400]  Eukaryotic type   Check point factors    Other check point factors     111175442 Exosome [BR:dle04147]  Exosomal proteins   Proteins found in most exosomes    111175442 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  14-3-3 Motif Other DBs NCBI-GeneID:  111175442 NCBI-ProteinID:  XP_022430709 UniProt:  A0A2Y9N7J7 LinkDB All DBs Position Unknown AA seq 153 aa AA seqDB search MVRAYREKIDKELVCQDELVCQDELSLLDKYQIKNCQDGRYESKVLYLNMKGDYYRYLAK VTTGEKRATFEESSEKTCSEAHEVSKGHTQPAHPIRLGLALNYCLFYYEIRNAKEQACHL AKTTYNSAIAKLDTLSGDSYRDSTLIMQLLPTT NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atggtacgtgcttaccgtgaaaaaatagacaaggagctggtgtgtcaggatgagctggtg tgtcaggatgagctgagcctgctggataaataccagatcaagaattgccaggacggccgg tatgagagcaaagtgttgtacctgaatatgaaaggggactattaccgctacctggccaaa gtcaccactggagagaagagggcgaccttcgaggagtcatctgagaagacatgtagcgaa gcccacgaggtcagcaaagggcacacgcagcccgctcaccccattagattaggcctggcc cttaactactgccttttctactatgagatccggaatgccaaagagcaagcctgccacttg gccaagacaacttacaatagcgccattgccaagcttgacactctcagtggagactcctac agggactccacgctcatcatgcagctcctcccgacaacctaa

DBGET integrated database retrieval system