Delphinapterus leucas (beluga whale): 111176675 Help Entry 111176675         CDS       T05885                                  Symbol RHEB Name (RefSeq) GTP-binding protein Rheb   KO K07208   Ras homolog enriched in brain Organism dle  Delphinapterus leucas (beluga whale) Pathway dle04072   Phospholipase D signaling pathway dle04140   Autophagy - animal dle04150   mTOR signaling pathway dle04151   PI3K-Akt signaling pathway dle04152   AMPK signaling pathway dle04211   Longevity regulating pathway dle04218   Cellular senescence dle04714   Thermogenesis dle04910   Insulin signaling pathway dle04919   Thyroid hormone signaling pathway dle05163   Human cytomegalovirus infection dle05165   Human papillomavirus infection dle05168   Herpes simplex virus 1 infection dle05231   Choline metabolism in cancer Brite KEGG Orthology (KO) [BR:dle00001]  09130 Environmental Information Processing   09132 Signal transduction    04072 Phospholipase D signaling pathway     111176675 (RHEB)    04151 PI3K-Akt signaling pathway     111176675 (RHEB)    04152 AMPK signaling pathway     111176675 (RHEB)    04150 mTOR signaling pathway     111176675 (RHEB)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     111176675 (RHEB)   09143 Cell growth and death    04218 Cellular senescence     111176675 (RHEB)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     111176675 (RHEB)    04919 Thyroid hormone signaling pathway     111176675 (RHEB)   09149 Aging    04211 Longevity regulating pathway     111176675 (RHEB)   09159 Environmental adaptation    04714 Thermogenesis     111176675 (RHEB)  09160 Human Diseases   09161 Cancer: overview    05231 Choline metabolism in cancer     111176675 (RHEB)   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     111176675 (RHEB)    05163 Human cytomegalovirus infection     111176675 (RHEB)    05165 Human papillomavirus infection     111176675 (RHEB)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:dle04031]     111176675 (RHEB) GTP-binding proteins [BR:dle04031]  Small (monomeric) G-proteins   Ras Family    Rheb     111176675 (RHEB) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase SRPRB AAA_14 RhoGAP_pG1_pG2 DUF1842 Motif Other DBs NCBI-GeneID:  111176675 NCBI-ProteinID:  XP_022433124 UniProt:  A0A2Y9NDX9 LinkDB All DBs Position Unknown AA seq 184 aa AA seqDB search MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVD TAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNK KDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVFRRIILEAEKIDGAASQGKSS CLVM NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgccgcagtccaagtcccggaagatcgcgatcctgggctaccggtctgtggggaaatcc tcattgacgattcagtttgttgaaggccaatttgttgattcctacgatccaaccatagaa aacactttcacaaaattgatcacagtaaatggacaagaatatcatcttcaacttgtagat acagctgggcaggatgaatattccatctttcctcagacatactccatagatattaatggt tatattcttgtgtattctgttacatcaatcaaaagctttgaagtgatcaaagttatccat ggcaaactgttggatatggtggggaaagtacagatacctattatgttggttgggaataag aaagacctacatatggaaagggtgatcagttatgaagaagggaaagcgttagcagaatct tggaacgcagcttttttggagtcttctgctaaagaaaatcagactgctgttgatgttttt agaaggataattttggaggcagagaaaattgacggggccgcctcacaagggaagtcttcc tgcttggtgatgtga

DBGET integrated database retrieval system