Delphinapterus leucas (beluga whale): 111179550 Help Entry 111179550         CDS       T05885                                  Name (RefSeq) probable protein BRICK1   KO K05752   chromosome 3 open reading frame 10 Organism dle  Delphinapterus leucas (beluga whale) Pathway dle04810   Regulation of actin cytoskeleton dle05132   Salmonella infection Brite KEGG Orthology (KO) [BR:dle00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     111179550  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     111179550 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CC_PcsB Motif Other DBs NCBI-GeneID:  111179550 NCBI-ProteinID:  XP_030616936 UniProt:  A0A7F8K309 LinkDB All DBs Position Unknown AA seq 58 aa AA seqDB search MVGQEDPVQRKVHQDGASWEYIEVITSSSKKIADFLHSGLATLNEKLTALEQRIEYTE NT seq 177 nt NT seq  +upstreamnt  +downstreamnt atggtgggacaagaggatccagtgcagcgcaaggttcaccaggacggggcgagctgggag tacattgaggtcatcaccagcagcagcaagaaaattgcagactttctccactcaggactc gcaacactaaacgagaaactgacagctcttgaacaaagaatagagtacactgaatga

DBGET integrated database retrieval system