KEGG   Delphinapterus leucas (beluga whale): 111179996
Entry
111179996         CDS       T05885                                 
Symbol
NRAS
Name
(RefSeq) GTPase NRas
  KO
K07828  GTPase NRas
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01521  EGFR tyrosine kinase inhibitor resistance
dle01522  Endocrine resistance
dle04010  MAPK signaling pathway
dle04012  ErbB signaling pathway
dle04014  Ras signaling pathway
dle04015  Rap1 signaling pathway
dle04062  Chemokine signaling pathway
dle04068  FoxO signaling pathway
dle04071  Sphingolipid signaling pathway
dle04072  Phospholipase D signaling pathway
dle04137  Mitophagy - animal
dle04140  Autophagy - animal
dle04150  mTOR signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04210  Apoptosis
dle04211  Longevity regulating pathway
dle04213  Longevity regulating pathway - multiple species
dle04218  Cellular senescence
dle04360  Axon guidance
dle04370  VEGF signaling pathway
dle04371  Apelin signaling pathway
dle04540  Gap junction
dle04550  Signaling pathways regulating pluripotency of stem cells
dle04625  C-type lectin receptor signaling pathway
dle04650  Natural killer cell mediated cytotoxicity
dle04660  T cell receptor signaling pathway
dle04662  B cell receptor signaling pathway
dle04664  Fc epsilon RI signaling pathway
dle04714  Thermogenesis
dle04720  Long-term potentiation
dle04722  Neurotrophin signaling pathway
dle04725  Cholinergic synapse
dle04726  Serotonergic synapse
dle04730  Long-term depression
dle04810  Regulation of actin cytoskeleton
dle04910  Insulin signaling pathway
dle04912  GnRH signaling pathway
dle04915  Estrogen signaling pathway
dle04916  Melanogenesis
dle04917  Prolactin signaling pathway
dle04919  Thyroid hormone signaling pathway
dle04921  Oxytocin signaling pathway
dle04926  Relaxin signaling pathway
dle04929  GnRH secretion
dle04933  AGE-RAGE signaling pathway in diabetic complications
dle04935  Growth hormone synthesis, secretion and action
dle05010  Alzheimer disease
dle05022  Pathways of neurodegeneration - multiple diseases
dle05034  Alcoholism
dle05160  Hepatitis C
dle05161  Hepatitis B
dle05163  Human cytomegalovirus infection
dle05165  Human papillomavirus infection
dle05166  Human T-cell leukemia virus 1 infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05170  Human immunodeficiency virus 1 infection
dle05200  Pathways in cancer
dle05203  Viral carcinogenesis
dle05205  Proteoglycans in cancer
dle05206  MicroRNAs in cancer
dle05207  Chemical carcinogenesis - receptor activation
dle05208  Chemical carcinogenesis - reactive oxygen species
dle05210  Colorectal cancer
dle05211  Renal cell carcinoma
dle05213  Endometrial cancer
dle05214  Glioma
dle05215  Prostate cancer
dle05216  Thyroid cancer
dle05218  Melanoma
dle05219  Bladder cancer
dle05220  Chronic myeloid leukemia
dle05221  Acute myeloid leukemia
dle05223  Non-small cell lung cancer
dle05224  Breast cancer
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
dle05230  Central carbon metabolism in cancer
dle05231  Choline metabolism in cancer
dle05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
dle05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111179996 (NRAS)
   04012 ErbB signaling pathway
    111179996 (NRAS)
   04014 Ras signaling pathway
    111179996 (NRAS)
   04015 Rap1 signaling pathway
    111179996 (NRAS)
   04370 VEGF signaling pathway
    111179996 (NRAS)
   04371 Apelin signaling pathway
    111179996 (NRAS)
   04068 FoxO signaling pathway
    111179996 (NRAS)
   04072 Phospholipase D signaling pathway
    111179996 (NRAS)
   04071 Sphingolipid signaling pathway
    111179996 (NRAS)
   04151 PI3K-Akt signaling pathway
    111179996 (NRAS)
   04150 mTOR signaling pathway
    111179996 (NRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111179996 (NRAS)
   04137 Mitophagy - animal
    111179996 (NRAS)
  09143 Cell growth and death
   04210 Apoptosis
    111179996 (NRAS)
   04218 Cellular senescence
    111179996 (NRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    111179996 (NRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    111179996 (NRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111179996 (NRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    111179996 (NRAS)
   04650 Natural killer cell mediated cytotoxicity
    111179996 (NRAS)
   04660 T cell receptor signaling pathway
    111179996 (NRAS)
   04662 B cell receptor signaling pathway
    111179996 (NRAS)
   04664 Fc epsilon RI signaling pathway
    111179996 (NRAS)
   04062 Chemokine signaling pathway
    111179996 (NRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    111179996 (NRAS)
   04929 GnRH secretion
    111179996 (NRAS)
   04912 GnRH signaling pathway
    111179996 (NRAS)
   04915 Estrogen signaling pathway
    111179996 (NRAS)
   04917 Prolactin signaling pathway
    111179996 (NRAS)
   04921 Oxytocin signaling pathway
    111179996 (NRAS)
   04926 Relaxin signaling pathway
    111179996 (NRAS)
   04935 Growth hormone synthesis, secretion and action
    111179996 (NRAS)
   04919 Thyroid hormone signaling pathway
    111179996 (NRAS)
   04916 Melanogenesis
    111179996 (NRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    111179996 (NRAS)
   04726 Serotonergic synapse
    111179996 (NRAS)
   04720 Long-term potentiation
    111179996 (NRAS)
   04730 Long-term depression
    111179996 (NRAS)
   04722 Neurotrophin signaling pathway
    111179996 (NRAS)
  09158 Development and regeneration
   04360 Axon guidance
    111179996 (NRAS)
  09149 Aging
   04211 Longevity regulating pathway
    111179996 (NRAS)
   04213 Longevity regulating pathway - multiple species
    111179996 (NRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    111179996 (NRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111179996 (NRAS)
   05206 MicroRNAs in cancer
    111179996 (NRAS)
   05205 Proteoglycans in cancer
    111179996 (NRAS)
   05207 Chemical carcinogenesis - receptor activation
    111179996 (NRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    111179996 (NRAS)
   05203 Viral carcinogenesis
    111179996 (NRAS)
   05230 Central carbon metabolism in cancer
    111179996 (NRAS)
   05231 Choline metabolism in cancer
    111179996 (NRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111179996 (NRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    111179996 (NRAS)
   05225 Hepatocellular carcinoma
    111179996 (NRAS)
   05226 Gastric cancer
    111179996 (NRAS)
   05214 Glioma
    111179996 (NRAS)
   05216 Thyroid cancer
    111179996 (NRAS)
   05221 Acute myeloid leukemia
    111179996 (NRAS)
   05220 Chronic myeloid leukemia
    111179996 (NRAS)
   05218 Melanoma
    111179996 (NRAS)
   05211 Renal cell carcinoma
    111179996 (NRAS)
   05219 Bladder cancer
    111179996 (NRAS)
   05215 Prostate cancer
    111179996 (NRAS)
   05213 Endometrial cancer
    111179996 (NRAS)
   05224 Breast cancer
    111179996 (NRAS)
   05223 Non-small cell lung cancer
    111179996 (NRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111179996 (NRAS)
   05170 Human immunodeficiency virus 1 infection
    111179996 (NRAS)
   05161 Hepatitis B
    111179996 (NRAS)
   05160 Hepatitis C
    111179996 (NRAS)
   05163 Human cytomegalovirus infection
    111179996 (NRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111179996 (NRAS)
   05165 Human papillomavirus infection
    111179996 (NRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111179996 (NRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    111179996 (NRAS)
  09165 Substance dependence
   05034 Alcoholism
    111179996 (NRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    111179996 (NRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    111179996 (NRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111179996 (NRAS)
   01522 Endocrine resistance
    111179996 (NRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dle04131]
    111179996 (NRAS)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dle04147]
    111179996 (NRAS)
   04031 GTP-binding proteins [BR:dle04031]
    111179996 (NRAS)
Membrane trafficking [BR:dle04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    111179996 (NRAS)
 Endocytosis
  Macropinocytosis
   Ras GTPases
    111179996 (NRAS)
Exosome [BR:dle04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   111179996 (NRAS)
  Exosomal proteins of other body fluids (saliva and urine)
   111179996 (NRAS)
  Exosomal proteins of breast cancer cells
   111179996 (NRAS)
  Exosomal proteins of colorectal cancer cells
   111179996 (NRAS)
GTP-binding proteins [BR:dle04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    111179996 (NRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N ParA
Other DBs
NCBI-GeneID: 111179996
NCBI-ProteinID: XP_022439708
UniProt: A0A2Y9PBA0
LinkDB
Position
Unknown
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL
PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG
CMGLPCVVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcactgaca
atccagctgatccagaaccactttgtagatgaatatgatcccaccatagaggattcttac
cgaaaacaggtggttatagatggtgaaacctgtctgttggacatactggatacagctgga
caagaggagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttcctttgt
gtatttgccatcaataatagcaaatcatttgcagatattaacctctacagggaacagatt
aagcgtgtaaaagactcagatgatgtacctatggtgctagtaggaaacaagtgtgatttg
ccaacaaggacagttgacacaaaacaagcccatgaactggccaagagttatgggattcca
ttcattgaaacctcagccaagaccagacagggtgttgaagatgccttttacacactggta
agagaaatacgtcagtaccgaatgaaaaaactcaacagcagtgatgatgggactcaaggt
tgtatgggattgccatgtgtagtgatgtaa

DBGET integrated database retrieval system