Delphinapterus leucas (beluga whale): 111182417 Help Entry 111182417         CDS       T05885                                  Symbol IL5 Name (RefSeq) interleukin-5   KO K05428   interleukin 5 Organism dle  Delphinapterus leucas (beluga whale) Pathway dle04060   Cytokine-cytokine receptor interaction dle04630   JAK-STAT signaling pathway dle04640   Hematopoietic cell lineage dle04657   IL-17 signaling pathway dle04658   Th1 and Th2 cell differentiation dle04660   T cell receptor signaling pathway dle04664   Fc epsilon RI signaling pathway dle04672   Intestinal immune network for IgA production dle05200   Pathways in cancer dle05310   Asthma dle05320   Autoimmune thyroid disease dle05321   Inflammatory bowel disease dle05330   Allograft rejection Brite KEGG Orthology (KO) [BR:dle00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     111182417 (IL5)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     111182417 (IL5)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     111182417 (IL5)    04660 T cell receptor signaling pathway     111182417 (IL5)    04658 Th1 and Th2 cell differentiation     111182417 (IL5)    04657 IL-17 signaling pathway     111182417 (IL5)    04664 Fc epsilon RI signaling pathway     111182417 (IL5)    04672 Intestinal immune network for IgA production     111182417 (IL5)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     111182417 (IL5)   09163 Immune disease    05310 Asthma     111182417 (IL5)    05320 Autoimmune thyroid disease     111182417 (IL5)    05321 Inflammatory bowel disease     111182417 (IL5)    05330 Allograft rejection     111182417 (IL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:dle04052]     111182417 (IL5)    00536 Glycosaminoglycan binding proteins [BR:dle00536]     111182417 (IL5) Cytokines and neuropeptides [BR:dle04052]  Cytokines   Interleukins    111182417 (IL5) Glycosaminoglycan binding proteins [BR:dle00536]  Heparan sulfate / Heparin   Cytokines    111182417 (IL5) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL5 Motif Other DBs NCBI-GeneID:  111182417 NCBI-ProteinID:  XP_022444472 UniProt:  A0A2Y9PMF3 LinkDB All DBs Position Unknown AA seq 135 aa AA seqDB search MRMLLHLSLLALGAVYICVIAVESPMNRLVAETLTLLSTHQTLLIGDGNLMIPTPEHTNH ELCIKEVFQGIDTLKNQTAQGDAVEKLFQNLFLIKEYIIDLQRKKCGGERWRVKQFLDYL QTFLKVINTEWTTES NT seq 408 nt NT seq  +upstreamnt  +downstreamnt atgagaatgcttctgcatttgagtttgctggctcttggagctgtctacatttgtgtcatt gctgtagaaagtcccatgaatagactggtggcagagaccttgacactgctctccactcat caaactctgctgataggtgacgggaatttgatgattcctactcccgaacatacaaatcac gagctatgcattaaagaagtctttcagggaatagacacactgaagaatcaaactgcacaa ggggatgctgtggaaaaactattccaaaacttgtttttaataaaagaatacataatagac ctccaaagaaagaagtgtggaggagaaagatggagagtaaaacaattcctagactacctg caaacttttcttaaggtgataaacaccgagtggacaacggaaagttga

DBGET integrated database retrieval system