Delphinapterus leucas (beluga whale): 111182816 Help Entry 111182816         CDS       T05885                                  Name (RefSeq) histone H3.3   KO K11253   histone H3 Organism dle  Delphinapterus leucas (beluga whale) Pathway dle04613   Neutrophil extracellular trap formation dle05034   Alcoholism dle05202   Transcriptional misregulation in cancer dle05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:dle00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     111182816  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     111182816   09163 Immune disease    05322 Systemic lupus erythematosus     111182816   09165 Substance dependence    05034 Alcoholism     111182816  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:dle03036]     111182816   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dle04147]     111182816 Chromosome and associated proteins [BR:dle03036]  Eukaryotic type   Nucleosome assembly factors    Histones     111182816 Exosome [BR:dle04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    111182816 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF TFIID-31kDa Motif Other DBs NCBI-GeneID:  111182816 NCBI-ProteinID:  XP_022445293 UniProt:  A0A2Y9PQZ8 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggcccgaaccaagcagactgctcgtaagtccacgggtggcaaagcgccccgcaaacag ctggccactaaagcggccaggaaaagcgccccctctaccggcggggtgaaaaaacctcat cgctacaggcccgggaccgttgcgcttcgagaaatccgtcgttaccagaaatccaccgag cttctgatccggaagctgcctttccagaggttggtgagggagatcgcccaggatttcaaa accgacttgaggttccagagtgccgccattggtgcgcttcaggaggctagtgaagcgtac ctggtgggtttatttgaagatactaatctgtgtgccatccacgctaagagagtcaccatc atgcccaaagacatccagttggctcgccggatacggggagagagagcttaa

DBGET integrated database retrieval system