Delphinapterus leucas (beluga whale): 111183603 Help Entry 111183603         CDS       T05885                                  Symbol FGF3 Name (RefSeq) fibroblast growth factor 3   KO K04358   fibroblast growth factor Organism dle  Delphinapterus leucas (beluga whale) Pathway dle04010   MAPK signaling pathway dle04014   Ras signaling pathway dle04015   Rap1 signaling pathway dle04020   Calcium signaling pathway dle04151   PI3K-Akt signaling pathway dle04810   Regulation of actin cytoskeleton dle05200   Pathways in cancer dle05207   Chemical carcinogenesis - receptor activation dle05218   Melanoma dle05224   Breast cancer dle05226   Gastric cancer Brite KEGG Orthology (KO) [BR:dle00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     111183603 (FGF3)    04014 Ras signaling pathway     111183603 (FGF3)    04015 Rap1 signaling pathway     111183603 (FGF3)    04020 Calcium signaling pathway     111183603 (FGF3)    04151 PI3K-Akt signaling pathway     111183603 (FGF3)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     111183603 (FGF3)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     111183603 (FGF3)    05207 Chemical carcinogenesis - receptor activation     111183603 (FGF3)   09162 Cancer: specific types    05226 Gastric cancer     111183603 (FGF3)    05218 Melanoma     111183603 (FGF3)    05224 Breast cancer     111183603 (FGF3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:dle04052]     111183603 (FGF3)    00536 Glycosaminoglycan binding proteins [BR:dle00536]     111183603 (FGF3) Cytokines and neuropeptides [BR:dle04052]  Cytokines   Growth factors (RTK binding)    111183603 (FGF3) Glycosaminoglycan binding proteins [BR:dle00536]  Heparan sulfate / Heparin   Growth factors/receptors    111183603 (FGF3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  FGF Fascin Motif Other DBs NCBI-GeneID:  111183603 NCBI-ProteinID:  XP_022446757 UniProt:  A0A2Y9PTW0 LinkDB All DBs Position Unknown AA seq 214 aa AA seqDB search MGLIWLLLLGLLEPGWPAAGPGGRLRRDAGGRGGVYEHLGGAPRRRKLYCATKYHLQLHP SGRVNGSLENSAYSILEITAVEVGVVAIKGLFSGRYLAMNKKGRLYASESYNAECEFVER IHELGYNTYASRLYRTVPGGRGARRQPSAERLWYVSVNGKGRPRRGFKTRRTQKSSLFLP RVLDHKDHEMVRLLQGAAGLRRRQSRPPGRATQP NT seq 645 nt NT seq  +upstreamnt  +downstreamnt atgggcctgatctggcttctgctgctcggcctgctggagcccggctggccggccgcgggc cccggggggcggctgcggcgcgatgcgggcggccgcggcggggtctacgagcacctcggc ggggcgccccggcgccgcaagctctactgcgccaccaagtaccacctccagcttcacccg agcggccgcgtcaacggcagcctagagaacagcgcctacagtatcctggagataacagca gtggaggtgggcgttgtggccatcaaagggctcttctccgggcggtacttggccatgaac aagaagggacggctctatgcttcggagagctacaacgccgagtgtgaattcgtggagcgc atccatgagctgggctacaacacgtacgcctcccggctgtaccgcacggtacccggcggg cgtggggcccggcgccagcccagcgccgagagactgtggtacgtgtctgtgaatggcaag ggccggccccgcaggggcttcaagacgcgccgcacgcagaagtcctcgctgttcctgcct cgggtgctggaccacaaggaccacgagatggtgaggctgctccagggtgcggccgggctc cgccgcagacagtccaggcctccaggcagggccacccagccctga

DBGET integrated database retrieval system