Delphinapterus leucas (beluga whale): 111183606 Help Entry 111183606         CDS       T05885                                  Symbol INS Name (RefSeq) insulin isoform X1   KO K04526   insulin Organism dle  Delphinapterus leucas (beluga whale) Pathway dle04010   MAPK signaling pathway dle04014   Ras signaling pathway dle04015   Rap1 signaling pathway dle04022   cGMP-PKG signaling pathway dle04066   HIF-1 signaling pathway dle04068   FoxO signaling pathway dle04072   Phospholipase D signaling pathway dle04081   Hormone signaling dle04114   Oocyte meiosis dle04140   Autophagy - animal dle04150   mTOR signaling pathway dle04151   PI3K-Akt signaling pathway dle04152   AMPK signaling pathway dle04211   Longevity regulating pathway dle04213   Longevity regulating pathway - multiple species dle04810   Regulation of actin cytoskeleton dle04910   Insulin signaling pathway dle04911   Insulin secretion dle04913   Ovarian steroidogenesis dle04914   Progesterone-mediated oocyte maturation dle04917   Prolactin signaling pathway dle04923   Regulation of lipolysis in adipocytes dle04930   Type II diabetes mellitus dle04931   Insulin resistance dle04932   Non-alcoholic fatty liver disease dle04940   Type I diabetes mellitus dle04950   Maturity onset diabetes of the young dle04960   Aldosterone-regulated sodium reabsorption dle05010   Alzheimer disease dle05215   Prostate cancer dle05415   Diabetic cardiomyopathy Brite KEGG Orthology (KO) [BR:dle00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     111183606 (INS)    04014 Ras signaling pathway     111183606 (INS)    04015 Rap1 signaling pathway     111183606 (INS)    04066 HIF-1 signaling pathway     111183606 (INS)    04068 FoxO signaling pathway     111183606 (INS)    04072 Phospholipase D signaling pathway     111183606 (INS)    04022 cGMP-PKG signaling pathway     111183606 (INS)    04151 PI3K-Akt signaling pathway     111183606 (INS)    04152 AMPK signaling pathway     111183606 (INS)    04150 mTOR signaling pathway     111183606 (INS)   09133 Signaling molecules and interaction    04081 Hormone signaling     111183606 (INS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     111183606 (INS)   09143 Cell growth and death    04114 Oocyte meiosis     111183606 (INS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     111183606 (INS)  09150 Organismal Systems   09152 Endocrine system    04911 Insulin secretion     111183606 (INS)    04910 Insulin signaling pathway     111183606 (INS)    04923 Regulation of lipolysis in adipocytes     111183606 (INS)    04913 Ovarian steroidogenesis     111183606 (INS)    04914 Progesterone-mediated oocyte maturation     111183606 (INS)    04917 Prolactin signaling pathway     111183606 (INS)   09155 Excretory system    04960 Aldosterone-regulated sodium reabsorption     111183606 (INS)   09149 Aging    04211 Longevity regulating pathway     111183606 (INS)    04213 Longevity regulating pathway - multiple species     111183606 (INS)  09160 Human Diseases   09162 Cancer: specific types    05215 Prostate cancer     111183606 (INS)   09164 Neurodegenerative disease    05010 Alzheimer disease     111183606 (INS)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     111183606 (INS)   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     111183606 (INS)    04940 Type I diabetes mellitus     111183606 (INS)    04950 Maturity onset diabetes of the young     111183606 (INS)    04932 Non-alcoholic fatty liver disease     111183606 (INS)    04931 Insulin resistance     111183606 (INS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:dle04052]     111183606 (INS) Cytokines and neuropeptides [BR:dle04052]  Neuropeptides   Unclassified    111183606 (INS) SSDB OrthologParalogGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  111183606 NCBI-ProteinID:  XP_022446762 UniProt:  A0A2Y9PTW5 LinkDB All DBs Position Unknown AA seq 110 aa AA seqDB search MVLWMRLVPLLALLALWAPAPARAFVNQHLCGSHLVEALYLVCGERGFFYTPKARREVES PQVGAVELGGGPGAGGLQPPALEGPPQKRGIVEQCCTSICSLYQLENYCN NT seq 333 nt NT seq  +upstreamnt  +downstreamnt atggtcctgtggatgcgcctggtgcccctgctggccctgctggccctctgggcgcccgcc cctgcccgggccttcgtcaaccagcacctgtgcggctcccacctggtggaggcactgtac ctggtgtgcggggagcgtggcttcttctacacgcccaaggcccgccgggaggtggagagc ccgcaggtgggggccgtggagctgggtggaggccccggtgcaggcggcctgcagcccccg gccctggaggggcccccgcagaagcgcggcatcgtggagcagtgctgcaccagcatttgc tccctctaccagctggagaactactgcaactag

DBGET integrated database retrieval system