Delphinapterus leucas (beluga whale): 111183682 Help Entry 111183682         CDS       T05885                                  Symbol POLD4 Name (RefSeq) DNA polymerase delta subunit 4   KO K03505   DNA polymerase delta subunit 4 Organism dle  Delphinapterus leucas (beluga whale) Pathway dle03030   DNA replication dle03410   Base excision repair dle03420   Nucleotide excision repair dle03430   Mismatch repair dle03440   Homologous recombination Brite KEGG Orthology (KO) [BR:dle00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     111183682 (POLD4)    03410 Base excision repair     111183682 (POLD4)    03420 Nucleotide excision repair     111183682 (POLD4)    03430 Mismatch repair     111183682 (POLD4)    03440 Homologous recombination     111183682 (POLD4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:dle03032]     111183682 (POLD4)    03400 DNA repair and recombination proteins [BR:dle03400]     111183682 (POLD4) DNA replication proteins [BR:dle03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase delta complex     111183682 (POLD4) DNA repair and recombination proteins [BR:dle03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase delta complex       111183682 (POLD4)    MMR (mismatch excision repair)     DNA polymerase delta complex      111183682 (POLD4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  DNA_pol_delta_4 DUF3303 Motif Other DBs NCBI-GeneID:  111183682 NCBI-ProteinID:  XP_022447001 UniProt:  A0A2Y9PMM7 LinkDB All DBs Position Unknown AA seq 107 aa AA seqDB search MGRKRLITDSYPVVKRREGSAGHSKGELAPELGEEPQPLSVDEAEMELLRQFDLAWQYGP CTGITRLQRWHRAEQMGLEPPQEVWQVLQTHPGDPRFQCSLWHLYPL NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atgggccggaaacggctcatcactgactcctaccctgtagtgaagaggagggagggctcc gctgggcacagcaagggggagctggcaccagagctaggggaagagccccagcccctgagc gtggatgaagcggagatggagctgctgaggcagtttgacctggcctggcagtatgggccc tgcacagggatcacacggctgcaacgctggcatcgcgcagagcagatgggcttagagcct ccccaagaagtgtggcaggtgctgcagacccaccccggtgatccgcgcttccagtgcagc ctctggcatctctatcccctctga

DBGET integrated database retrieval system