Delphinapterus leucas (beluga whale): 111186607 Help Entry 111186607         CDS       T05885                                  Symbol PPP3R1 Name (RefSeq) calcineurin subunit B type 1   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism dle  Delphinapterus leucas (beluga whale) Pathway dle04010   MAPK signaling pathway dle04020   Calcium signaling pathway dle04022   cGMP-PKG signaling pathway dle04114   Oocyte meiosis dle04218   Cellular senescence dle04310   Wnt signaling pathway dle04360   Axon guidance dle04370   VEGF signaling pathway dle04380   Osteoclast differentiation dle04625   C-type lectin receptor signaling pathway dle04650   Natural killer cell mediated cytotoxicity dle04658   Th1 and Th2 cell differentiation dle04659   Th17 cell differentiation dle04660   T cell receptor signaling pathway dle04662   B cell receptor signaling pathway dle04720   Long-term potentiation dle04724   Glutamatergic synapse dle04921   Oxytocin signaling pathway dle04922   Glucagon signaling pathway dle04924   Renin secretion dle05010   Alzheimer disease dle05014   Amyotrophic lateral sclerosis dle05020   Prion disease dle05022   Pathways of neurodegeneration - multiple diseases dle05031   Amphetamine addiction dle05152   Tuberculosis dle05163   Human cytomegalovirus infection dle05166   Human T-cell leukemia virus 1 infection dle05167   Kaposi sarcoma-associated herpesvirus infection dle05170   Human immunodeficiency virus 1 infection dle05235   PD-L1 expression and PD-1 checkpoint pathway in cancer dle05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:dle00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     111186607 (PPP3R1)    04310 Wnt signaling pathway     111186607 (PPP3R1)    04370 VEGF signaling pathway     111186607 (PPP3R1)    04020 Calcium signaling pathway     111186607 (PPP3R1)    04022 cGMP-PKG signaling pathway     111186607 (PPP3R1)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     111186607 (PPP3R1)    04218 Cellular senescence     111186607 (PPP3R1)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     111186607 (PPP3R1)    04650 Natural killer cell mediated cytotoxicity     111186607 (PPP3R1)    04660 T cell receptor signaling pathway     111186607 (PPP3R1)    04658 Th1 and Th2 cell differentiation     111186607 (PPP3R1)    04659 Th17 cell differentiation     111186607 (PPP3R1)    04662 B cell receptor signaling pathway     111186607 (PPP3R1)   09152 Endocrine system    04922 Glucagon signaling pathway     111186607 (PPP3R1)    04921 Oxytocin signaling pathway     111186607 (PPP3R1)    04924 Renin secretion     111186607 (PPP3R1)   09156 Nervous system    04724 Glutamatergic synapse     111186607 (PPP3R1)    04720 Long-term potentiation     111186607 (PPP3R1)   09158 Development and regeneration    04360 Axon guidance     111186607 (PPP3R1)    04380 Osteoclast differentiation     111186607 (PPP3R1)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     111186607 (PPP3R1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     111186607 (PPP3R1)    05170 Human immunodeficiency virus 1 infection     111186607 (PPP3R1)    05163 Human cytomegalovirus infection     111186607 (PPP3R1)    05167 Kaposi sarcoma-associated herpesvirus infection     111186607 (PPP3R1)   09171 Infectious disease: bacterial    05152 Tuberculosis     111186607 (PPP3R1)   09164 Neurodegenerative disease    05010 Alzheimer disease     111186607 (PPP3R1)    05014 Amyotrophic lateral sclerosis     111186607 (PPP3R1)    05020 Prion disease     111186607 (PPP3R1)    05022 Pathways of neurodegeneration - multiple diseases     111186607 (PPP3R1)   09165 Substance dependence    05031 Amphetamine addiction     111186607 (PPP3R1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     111186607 (PPP3R1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:dle01009]     111186607 (PPP3R1) Protein phosphatases and associated proteins [BR:dle01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      111186607 (PPP3R1) SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 EF-hand_FSTL1 EF_SSP120 EH SPARC_Ca_bdg EF-hand_9 RSA-1_C Motif Other DBs NCBI-GeneID:  111186607 NCBI-ProteinID:  XP_022453058 UniProt:  A0A2Y9QC60 LinkDB All DBs Position Unknown AA seq 170 aa AA seqDB search MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVID IFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMV GNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV NT seq 513 nt NT seq  +upstreamnt  +downstreamnt atgggaaatgaggcaagttatcctttggaaatgtgctcacactttgatgctgatgaaatt aaaaggctaggaaagagatttaagaagctcgatttggacaattctggttctttgagtgtg gaagagttcatgtctctgcctgagttacaacagaatcccttagtacagcgagtaatagat atatttgacacagatgggaatggagaagtagactttaaagagttcattgagggagtctct cagttcagtgtcaaaggagataaggaacagaagttgaggtttgctttccgtatctatgac atggataaagacggctatatttccaatggggaactcttccaggtgctgaagatgatggtg gggaacaatctgaaagatacacagttacagcaaatcgtggacaaaaccataataaatgca gataaggatggagatggaagaatatcctttgaagaattctgtgctgttgtaggcggcctc gatattcacaaaaagatggtggtagacgtgtga

DBGET integrated database retrieval system