Delphinapterus leucas (beluga whale): 111187492 Help Entry 111187492         CDS       T05885                                  Symbol IL1B Name (RefSeq) interleukin-1 beta   KO K04519   interleukin 1 beta Organism dle  Delphinapterus leucas (beluga whale) Pathway dle01523   Antifolate resistance dle04010   MAPK signaling pathway dle04060   Cytokine-cytokine receptor interaction dle04064   NF-kappa B signaling pathway dle04217   Necroptosis dle04380   Osteoclast differentiation dle04620   Toll-like receptor signaling pathway dle04621   NOD-like receptor signaling pathway dle04623   Cytosolic DNA-sensing pathway dle04625   C-type lectin receptor signaling pathway dle04640   Hematopoietic cell lineage dle04657   IL-17 signaling pathway dle04659   Th17 cell differentiation dle04668   TNF signaling pathway dle04750   Inflammatory mediator regulation of TRP channels dle04932   Non-alcoholic fatty liver disease dle04933   AGE-RAGE signaling pathway in diabetic complications dle04936   Alcoholic liver disease dle04940   Type I diabetes mellitus dle05010   Alzheimer disease dle05020   Prion disease dle05022   Pathways of neurodegeneration - multiple diseases dle05132   Salmonella infection dle05133   Pertussis dle05134   Legionellosis dle05135   Yersinia infection dle05140   Leishmaniasis dle05142   Chagas disease dle05143   African trypanosomiasis dle05144   Malaria dle05146   Amoebiasis dle05152   Tuberculosis dle05162   Measles dle05163   Human cytomegalovirus infection dle05164   Influenza A dle05168   Herpes simplex virus 1 infection dle05171   Coronavirus disease - COVID-19 dle05321   Inflammatory bowel disease dle05323   Rheumatoid arthritis dle05332   Graft-versus-host disease dle05417   Lipid and atherosclerosis dle05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:dle00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     111187492 (IL1B)    04064 NF-kappa B signaling pathway     111187492 (IL1B)    04668 TNF signaling pathway     111187492 (IL1B)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     111187492 (IL1B)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     111187492 (IL1B)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     111187492 (IL1B)    04620 Toll-like receptor signaling pathway     111187492 (IL1B)    04621 NOD-like receptor signaling pathway     111187492 (IL1B)    04623 Cytosolic DNA-sensing pathway     111187492 (IL1B)    04625 C-type lectin receptor signaling pathway     111187492 (IL1B)    04659 Th17 cell differentiation     111187492 (IL1B)    04657 IL-17 signaling pathway     111187492 (IL1B)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     111187492 (IL1B)   09158 Development and regeneration    04380 Osteoclast differentiation     111187492 (IL1B)  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     111187492 (IL1B)    05164 Influenza A     111187492 (IL1B)    05162 Measles     111187492 (IL1B)    05168 Herpes simplex virus 1 infection     111187492 (IL1B)    05163 Human cytomegalovirus infection     111187492 (IL1B)   09171 Infectious disease: bacterial    05132 Salmonella infection     111187492 (IL1B)    05135 Yersinia infection     111187492 (IL1B)    05133 Pertussis     111187492 (IL1B)    05134 Legionellosis     111187492 (IL1B)    05152 Tuberculosis     111187492 (IL1B)   09174 Infectious disease: parasitic    05146 Amoebiasis     111187492 (IL1B)    05144 Malaria     111187492 (IL1B)    05140 Leishmaniasis     111187492 (IL1B)    05142 Chagas disease     111187492 (IL1B)    05143 African trypanosomiasis     111187492 (IL1B)   09163 Immune disease    05323 Rheumatoid arthritis     111187492 (IL1B)    05321 Inflammatory bowel disease     111187492 (IL1B)    05332 Graft-versus-host disease     111187492 (IL1B)   09164 Neurodegenerative disease    05010 Alzheimer disease     111187492 (IL1B)    05020 Prion disease     111187492 (IL1B)    05022 Pathways of neurodegeneration - multiple diseases     111187492 (IL1B)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     111187492 (IL1B)    05418 Fluid shear stress and atherosclerosis     111187492 (IL1B)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     111187492 (IL1B)    04936 Alcoholic liver disease     111187492 (IL1B)    04932 Non-alcoholic fatty liver disease     111187492 (IL1B)    04933 AGE-RAGE signaling pathway in diabetic complications     111187492 (IL1B)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     111187492 (IL1B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:dle04052]     111187492 (IL1B)    00536 Glycosaminoglycan binding proteins [BR:dle00536]     111187492 (IL1B) Cytokines and neuropeptides [BR:dle04052]  Cytokines   Interleukins    111187492 (IL1B) Glycosaminoglycan binding proteins [BR:dle00536]  Heparan sulfate / Heparin   Cytokines    111187492 (IL1B) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL1 IL1_propep Motif Other DBs NCBI-GeneID:  111187492 NCBI-ProteinID:  XP_022454935 UniProt:  Q8WNR2 A0A2Y9QBK0 LinkDB All DBs Position Unknown AA seq 266 aa AA seqDB search MATVPEPTNEVMAYYSDENDLLFEADGPKQMKCCVQPLDLNSMGDGSIHLQISHQLYNKS LRRVVSVIVAVEKLQKIPCSQTFQDDGLRSIFSLIFEEEPVIFETYDDDLLCDAGVQSLT CKLQDRDQKSLVLASPCVLKALHLLARDVNREVVFCMSFVQGDESNDKIPVALGLKEKNL YLSCVMKGDRPTLQLEEVDPKTYPKWKMEKRFVFNKTEIKNSVEFESALYPNWYISTSQA EEKPIFLGRSKGGHDITDFTMEIISP NT seq 801 nt NT seq  +upstreamnt  +downstreamnt atggcaacggtacctgaacccaccaacgaagtgatggcttactacagtgacgagaatgac ctgttatttgaggctgacggtcccaaacagatgaagtgctgcgtccaacccctggacctc aactccatgggagatgggagcatccacctgcaaatctcccaccagctctacaacaaaagc ctcaggcgggtggtgtcggtcatcgtggccgtggagaagctgcagaagatcccctgctca cagaccttccaggatgatggcctgaggagcatcttttcactcatctttgaagaagagcct gtcatctttgaaacatacgatgatgatcttctgtgcgacgcgggtgtgcagtcgctgacc tgcaaactccaggacagagaccaaaaatccctggtgctggctagcccgtgtgtgctgaag gctctccacctcctcgcacgggacgtgaaccgagaagtggttttctgcatgagcttcgtg caaggagatgaaagtaacgacaagatacctgtggccttaggcctcaaggaaaagaatcta tacctgtcttgtgtgatgaaaggcgataggcccaccctgcagctggaggaggtagacccc aaaacttacccaaagtggaagatggaaaagcgatttgtcttcaacaagacagaaatcaag aatagcgtcgaatttgaatctgccctgtaccccaactggtacatcagcacctctcaagca gaagaaaagcccatcttcctaggacgttccaaaggcggccatgatataactgacttcacc atggaaatcatctctccctaa

DBGET integrated database retrieval system