Delphinapterus leucas (beluga whale): 111187501 Help Entry 111187501         CDS       T05885                                  Symbol IL1A Name (RefSeq) interleukin-1 alpha   KO K04383   interleukin 1 alpha Organism dle  Delphinapterus leucas (beluga whale) Pathway dle04010   MAPK signaling pathway dle04060   Cytokine-cytokine receptor interaction dle04217   Necroptosis dle04218   Cellular senescence dle04380   Osteoclast differentiation dle04640   Hematopoietic cell lineage dle04932   Non-alcoholic fatty liver disease dle04933   AGE-RAGE signaling pathway in diabetic complications dle04940   Type I diabetes mellitus dle05010   Alzheimer disease dle05020   Prion disease dle05022   Pathways of neurodegeneration - multiple diseases dle05133   Pertussis dle05140   Leishmaniasis dle05152   Tuberculosis dle05162   Measles dle05164   Influenza A dle05321   Inflammatory bowel disease dle05323   Rheumatoid arthritis dle05332   Graft-versus-host disease dle05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:dle00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     111187501 (IL1A)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     111187501 (IL1A)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     111187501 (IL1A)    04218 Cellular senescence     111187501 (IL1A)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     111187501 (IL1A)   09158 Development and regeneration    04380 Osteoclast differentiation     111187501 (IL1A)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     111187501 (IL1A)    05162 Measles     111187501 (IL1A)   09171 Infectious disease: bacterial    05133 Pertussis     111187501 (IL1A)    05152 Tuberculosis     111187501 (IL1A)   09174 Infectious disease: parasitic    05140 Leishmaniasis     111187501 (IL1A)   09163 Immune disease    05323 Rheumatoid arthritis     111187501 (IL1A)    05321 Inflammatory bowel disease     111187501 (IL1A)    05332 Graft-versus-host disease     111187501 (IL1A)   09164 Neurodegenerative disease    05010 Alzheimer disease     111187501 (IL1A)    05020 Prion disease     111187501 (IL1A)    05022 Pathways of neurodegeneration - multiple diseases     111187501 (IL1A)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     111187501 (IL1A)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     111187501 (IL1A)    04932 Non-alcoholic fatty liver disease     111187501 (IL1A)    04933 AGE-RAGE signaling pathway in diabetic complications     111187501 (IL1A)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:dle04052]     111187501 (IL1A) Cytokines and neuropeptides [BR:dle04052]  Cytokines   Interleukins    111187501 (IL1A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL1_propep IL1 Motif Other DBs NCBI-GeneID:  111187501 NCBI-ProteinID:  XP_022454953 UniProt:  A0A2Y9Q796 LinkDB All DBs Position Unknown AA seq 265 aa AA seqDB search MAKVPDLFEDLKNCYSENEEYSSEIDHLSLNQKSFYDASYEPLHQDCIDKYMSLNTPETS KTSKLTFKENVMMVAANGKILKNRWLSLNRFLTDDDLEDIADGTEEEIIKPRSAHYSFQS NMKYNFIKLIQQQYILNDALHQSIVLHPSGQYLMAAALNNLDEAVEFDIAAYTSGDDTQL PVTLRISKTQLFVCAQNEDEPVLLKEMPETPQTIKDETNLLFLWSNHGSMQHFKSVAYPK LYFATKQEKPVHLARGPPSIIDFQL NT seq 798 nt NT seq  +upstreamnt  +downstreamnt atggccaaagtccctgacctctttgaagacctgaagaactgttacagtgaaaatgaagaa tacagttccgaaattgaccatctgtctctgaatcagaagtccttctatgatgcaagctat gaaccacttcatcaggactgcatagataaatatatgtctctgaatacccctgaaacctct aagacatccaagcttaccttcaaggaaaatgtgatgatggtggcagccaacgggaagatt ctgaagaacagatggttgagtttaaatcggttcctcaccgacgatgacctggaagacatt gccgatggtacagaagaagaaatcatcaagcccagatcagcacattacagcttccagagc aacatgaaatacaactttatcaagctcatccaacagcaatacatcctgaatgacgccctc catcaaagtatagttctacatccgtcaggtcaatacctcatggctgctgcattaaataat ctggatgaggcagtggaatttgacatagctgcttatacatcaggagacgatactcaactt cctgtgactctaagaatctcaaaaactcaactgtttgtttgtgctcaaaatgaagacgaa cccgtattgctaaaggagatgcctgagacaccccagaccatcaaagatgagaccaatctc ctcttcctctggagcaaccatggcagtatgcaacacttcaaatcagttgcctatcccaag ttgtattttgccacaaagcaagaaaaaccggtgcacctggcgaggggcccgccctctatc attgactttcagctttga

DBGET integrated database retrieval system