Delphinapterus leucas (beluga whale): 115802482 Help Entry 115802482         CDS       T05885                                  Name (RefSeq) histone H3.1   KO K11253   histone H3 Organism dle  Delphinapterus leucas (beluga whale) Pathway dle04613   Neutrophil extracellular trap formation dle05034   Alcoholism dle05202   Transcriptional misregulation in cancer dle05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:dle00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     115802482  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     115802482   09163 Immune disease    05322 Systemic lupus erythematosus     115802482   09165 Substance dependence    05034 Alcoholism     115802482  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:dle03036]     115802482   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dle04147]     115802482 Chromosome and associated proteins [BR:dle03036]  Eukaryotic type   Nucleosome assembly factors    Histones     115802482 Exosome [BR:dle04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    115802482 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-S CENP-T_C CBFD_NFYB_HMF PAF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  115802482 NCBI-ProteinID:  XP_030616916 UniProt:  A0A2Y9M8B0 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgcactaagcagaccgctcgcaagtccaccggcggcaaggcgccgcgcaagcag ctggccaccaaggcggcccgcaagagcgcgccggccacgggcggcgtgaagaagccgcac cgctaccggcccggcacggtggccctgcgcgagatccgccgctaccagaagtccacggag ctgctgatccgcaagctsccgttccagcgcctggtgcgcgagatcgcgcaggacttcaag accgacctgcgyttccagagctcggccgtgatggcgctgcaggaggcgtgtgaggcctac ctggtggggctcttcgaggacaccaacctgtgtgccatccacgccaagcgcgtcaccatc atgcccaaggacatccagcttgcccgccgtatccgcggggagagggcgtga

DBGET integrated database retrieval system