Desulfonema limicola: dnl_58030 Help Entry dnl_58030         CDS       T07101                                  Symbol hup2 Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism dli  Desulfonema limicola Brite KEGG Orthology (KO) [BR:dli00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:dli03032]     dnl_58030 (hup2)    03036 Chromosome and associated proteins [BR:dli03036]     dnl_58030 (hup2)    03400 DNA repair and recombination proteins [BR:dli03400]     dnl_58030 (hup2) DNA replication proteins [BR:dli03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     dnl_58030 (hup2) Chromosome and associated proteins [BR:dli03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     dnl_58030 (hup2) DNA repair and recombination proteins [BR:dli03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       dnl_58030 (hup2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 Motif Other DBs NCBI-ProteinID:  QTA83399 UniProt:  A0A975GJC3 LinkDB All DBs Position 6187423..6187695 Genome browser AA seq 90 aa AA seqDB search MTKSELVDKIAEDAGIKKPEAAKALDSFMNNVIQALKKKDGKVTLVGFGTFSKVRRKARK GRNPQTGEEIKIKACNVVKFRPGKKLKDNI NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgacaaaatctgagttagtagacaagatagcagaagatgcaggtattaaaaaaccagag gctgccaaggccttggattcatttatgaacaatgttatccaggctttgaagaaaaaagat ggaaaagtaaccctggtaggttttggaaccttttcaaaagttcgccgtaaagccagaaaa ggacgcaatcctcagacaggggaagaaattaagattaaggcatgtaatgttgtgaaattc aggcctggcaagaaactgaaagacaatatataa

DBGET integrated database retrieval system