Desulfofustis limnaeus: DPPLL_06470 Help Entry DPPLL_06470       CDS       T09067                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism dlm  Desulfofustis limnaeus Pathway dlm00998   Biosynthesis of various antibiotics dlm01100   Metabolic pathways dlm01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dlm00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DPPLL_06470    00074 Mycolic acid biosynthesis     DPPLL_06470   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DPPLL_06470 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7433 Motif Other DBs NCBI-ProteinID:  BDD86282 UniProt:  A0ABM7W5W6 LinkDB All DBs Position 695650..695916 Genome browser AA seq 88 aa AA seqDB search MPVAAGLEQELLRLICSTCNLQDVDLTAVGPDDPLIGPDSPLGIDSLDALEIAVAVQREY GVRMNAEHTTREVMQTLASLAAYVHRNR NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgccagtagcagctggcctggaacaagaattgttgcgcctgatctgctccacctgcaac ctgcaggatgtggacctgacggccgtcggaccggacgatccgctcatcggaccggattcg ccgctcggtatcgattccctcgatgcgctggaaatcgccgtggccgtccagcgagaatat ggggtgcgaatgaacgccgagcacactacccgggaggtcatgcagacgttggcttcgctg gccgcctacgtgcaccgcaaccggtaa

DBGET integrated database retrieval system