Desulfofustis limnaeus: DPPLL_06620 Help Entry DPPLL_06620       CDS       T09067                                  Symbol acpP-1 Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism dlm  Desulfofustis limnaeus Pathway dlm00998   Biosynthesis of various antibiotics dlm01100   Metabolic pathways dlm01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dlm00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DPPLL_06620 (acpP-1)    00074 Mycolic acid biosynthesis     DPPLL_06620 (acpP-1)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DPPLL_06620 (acpP-1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding RuvA_N Motif Other DBs NCBI-ProteinID:  BDD86297 UniProt:  A0ABN6M4H5 LinkDB All DBs Position complement(712405..712668) Genome browser AA seq 87 aa AA seqDB search MDTLIAELKRKLIDILHLDDLTVDDIDEHAQLVGGDLGIDSIDVLEIVVMVEKDYGVVIN NQEIGAQVFASLATLADYIKAHTPASS NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atggacaccttaatcgcagagctcaagcgtaaactcatcgacatcctgcacctcgacgac ctgacggtcgacgatatcgacgaacatgcccaactcgtcggcggcgatctcggcatcgac tccatcgatgtcctggagatcgtggtcatggttgaaaaggattacggagttgtcatcaac aaccaggaaatcggcgcccaggtctttgcctccctggccacgctggcagactacatcaag gcacacacccccgcctcgtcttga

DBGET integrated database retrieval system