Desulfofustis limnaeus: DPPLL_06720 Help Entry DPPLL_06720       CDS       T09067                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism dlm  Desulfofustis limnaeus Pathway dlm00998   Biosynthesis of various antibiotics dlm01100   Metabolic pathways dlm01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dlm00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DPPLL_06720    00074 Mycolic acid biosynthesis     DPPLL_06720   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DPPLL_06720 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 GatC DUF5446 Motif Other DBs NCBI-ProteinID:  BDD86307 LinkDB All DBs Position 721599..721880 Genome browser AA seq 93 aa AA seqDB search MTREELQKRILTILEEEFEFESPGLDDNLRDDHGFDSIDAIELLAKIEKMLGISLSRQEK EQAMTIRTINDILDYIERMQAGRKTSNDSAPRP NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgaccagagaagaactgcaaaagcggattttgaccatcctcgaggaggagttcgagttc gagtctccggggctcgatgacaacttgcgcgacgaccacggtttcgatagcatcgacgcc atcgagctgttggccaagatcgagaaaatgctcggcatatccttgagtcgccaggaaaaa gagcaggcgatgaccatccgtaccatcaacgacatcctcgattacatcgagcggatgcaa gccggccggaaaacctcgaacgattcggcgccgcgcccatga

DBGET integrated database retrieval system