Desulfofustis limnaeus: DPPLL_10890 Help Entry DPPLL_10890       CDS       T09067                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism dlm  Desulfofustis limnaeus Pathway dlm00998   Biosynthesis of various antibiotics dlm01100   Metabolic pathways dlm01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dlm00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DPPLL_10890 (acpP)    00074 Mycolic acid biosynthesis     DPPLL_10890 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DPPLL_10890 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 Ribosomal_L12_N DUF1493 Motif Other DBs NCBI-ProteinID:  BDD86724 LinkDB All DBs Position 1160997..1161227 Genome browser AA seq 76 aa AA seqDB search MAIDQEMIDIIVEQLSVEKEKVVPQASFVDDLGADSLDLVELIMAMEEKFDIEIPDEDAE KIVTVQDAINYVGKLK NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggcgatcgatcaggaaatgattgacatcatcgtagaacaactgagtgttgagaaagag aaagtggttccgcaggcttcctttgttgacgatctgggcgccgattcgcttgatctggtg gaattgatcatggcgatggaggaaaagttcgatatcgaaatcccggacgaggatgccgag aagatcgttaccgttcaggatgccatcaactacgtcggcaagcttaagtag

DBGET integrated database retrieval system