Desulfofustis limnaeus: DPPLL_17250 Help Entry DPPLL_17250       CDS       T09067                                  Name (GenBank) hypothetical protein   KO K02398   negative regulator of flagellin synthesis FlgM Organism dlm  Desulfofustis limnaeus Pathway dlm02020   Two-component system dlm02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:dlm00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     DPPLL_17250  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     DPPLL_17250  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:dlm02035]     DPPLL_17250 Bacterial motility proteins [BR:dlm02035]  Flagellar system   Flagellar assembly proteins    Others     DPPLL_17250 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgM Motif Other DBs NCBI-ProteinID:  BDD87360 LinkDB All DBs Position 1844075..1844371 Genome browser AA seq 98 aa AA seqDB search MMIDFFGVGGPPNLGGPKKVVKPQAGKAGETQKSDQVEFSSVLQDVHRAQSGTSAAEAER AARVQQLKEQVANGTYQPDIQKVAASLLQYLVEANQKL NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgatgatcgatttcttcggagtcggcggtccccccaatctgggcgggccgaaaaaggtg gtcaaaccgcaggccggaaaggccggcgagacccagaagagcgaccaggtggagttctcc tccgtgctgcaggacgtgcaccgggcccagtcgggcaccagtgccgccgaggcggagcgg gccgcccgcgtccagcagttgaaggaacaggtggccaacggcacctatcagcctgatatt cagaaagttgccgcctcactgctgcaatacctggtggaagccaaccagaagctatga

DBGET integrated database retrieval system