KEGG   Diaphorobacter limosus: P4826_04095
Entry
P4826_04095       CDS       T10112                                 
Symbol
accC
Name
(GenBank) acetyl-CoA carboxylase biotin carboxylase subunit
  KO
K01965  propionyl-CoA carboxylase alpha subunit [EC:6.4.1.3]
Organism
dls  Diaphorobacter limosus
Pathway
dls00280  Valine, leucine and isoleucine degradation
dls00630  Glyoxylate and dicarboxylate metabolism
dls00640  Propanoate metabolism
dls01100  Metabolic pathways
dls01110  Biosynthesis of secondary metabolites
dls01120  Microbial metabolism in diverse environments
dls01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dls00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    P4826_04095 (accC)
   00640 Propanoate metabolism
    P4826_04095 (accC)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    P4826_04095 (accC)
Enzymes [BR:dls01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.3  propionyl-CoA carboxylase
     P4826_04095 (accC)
SSDB
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Biotin_lipoyl PCC_BT Dala_Dala_lig_C ATP-grasp ATP-grasp_3 Biotin_lipoyl_2 HlyD_3 GARS_A RnfC_N GCV_H ATPgrasp_ST NQRA_N
Other DBs
NCBI-ProteinID: WOO33275
UniProt: A0ABZ0J722
LinkDB
Position
complement(833234..835294)
AA seq 686 aa
MFTKILIANRGEIACRIITTAKRMGIATVAVYSDADKNARFVQLADEAVRLGPPPSRESY
LLADKIIEACKQTGAQAVHPGYGFLSENAEFAKKVEEQGIAFIGPKHAAIAAMGDKIASK
KLAGEARVSTIPGYNDAIETPEKAVEIAKGIGYPVMIKASAGGGGKGLRVAFNDKEAYEG
FASCKHEALSAFGDDRVFIEKFVEQPRHIEIQVLGDAHGNVVYLNERECSIQRRHQKVIE
EAPSPFISAATRKAMGEQAVQLAKAVGYQSAGTVEFVVGKDQDFYFLEMNTRLQVEHPVT
ELITGLDLVEQMIRVAAGEKLAFTQADVKCEGWAMECRINAEDPFRGFLPSTGRLVRFVP
PAQDLHQGLPATGLGVRVDTGVLDGGEIPMYYDSMIAKLIVHGKDRADAIARMREALNGF
VIKGVQSNIPFQAALLAHPDFVSGNFNTGFIAEHYAHGFRAEDVPHEDPSFLLALAAHLH
MFYRNRASGLQGQFWEGFKRLPRREFSVCVLGEGGHNSYTRATVAETEPGHATPVTLHLP
GGDKTYHLSVDRHLGEVRITGTVDGKAFTAQVERGKTSNPLAIRVIHNGTRLDAIVMHPR
TADLHRLMPYKAPPDLSKFVLSPMPGLLVQVAVQPGQEVKAGERVAVIEAMKMENVLLAS
ADGVVKEIKAQKGDSLAVDQAIVEFE
NT seq 2061 nt   +upstreamnt  +downstreamnt
atgttcaccaaaatcctgatagccaaccgcggcgagatcgcctgccgcatcatcaccacc
gccaagcgcatgggcattgccaccgtggcggtgtattccgacgccgacaagaacgcgcgc
ttcgtgcagctggccgacgaggccgtgcgcctgggcccgccgccgtcgcgcgagtcctac
ctgctggccgacaagatcatcgaggcctgcaagcagaccggcgctcaggccgtgcatccg
ggctatggctttctgtccgagaacgccgagttcgccaagaaggtggaagagcagggcatc
gccttcatcggccccaagcacgctgccattgccgccatgggtgacaagatcgcctccaag
aagctggcgggcgaggccagggtcagcaccatccccggctacaacgacgcgatagaaacg
cccgagaaggcggtggaaattgccaagggcattggctatccggtgatgatcaaggccagc
gcgggcggcggcggcaagggcctgcgcgtggccttcaatgacaaggaggcctatgaaggc
tttgcgtcctgcaagcacgaggcgctgagcgcctttggcgacgaccgcgtgttcatcgaa
aaattcgtcgagcagccgcgccatatcgagatccaggtgctgggcgacgcgcacggcaac
gtggtctatctgaatgagcgcgaatgctccatccagcggcgccatcaaaaggtgatcgag
gaagcgccttcgcccttcatcagcgccgccacgcgcaaggccatgggcgagcaggcggtg
cagctggccaaggccgtgggctaccagagcgcgggcacggtggagttcgtggtcggcaag
gatcaggatttctacttcctggagatgaacacccgcctgcaggtcgagcacccggtgacc
gagttgatcaccggcctggatctggtcgagcagatgatccgcgtggcggcgggcgagaag
ctggccttcacccaagcggatgtcaagtgcgaaggctgggccatggagtgccgcatcaat
gccgaagatccgttccgcggcttcctgccctccacggggcgcctggtgcgcttcgtaccg
ccggcgcaggacctgcaccagggcctgcctgccacggggctgggcgtgcgcgtggacacg
ggcgtgctggacggcggcgaaatcccgatgtactacgactcaatgatcgccaagctgatc
gtgcacggcaaggatcgtgccgacgccattgcccgcatgcgcgaggcgctcaacggcttc
gtcatcaagggcgtgcaaagcaacatcccattccaggccgcgctgctggcgcacccggat
ttcgtcagcggcaacttcaacaccggcttcatcgccgagcactatgcacatggctttcgg
gccgaggatgtgccgcatgaagacccgtcgttcctgctggcgctggcggcgcatctgcac
atgttctaccgcaaccgcgccagcgggctgcagggccagttctgggagggcttcaagcgc
ctgccgcggcgcgagttctcggtatgcgtgctgggcgagggcgggcacaacagctacacc
cgggccaccgtggccgaaaccgagcccggccacgccacgcccgtgaccctgcacctgccg
ggtggcgacaagacctaccacctgagcgtcgatcgccacctgggcgaggtgcgcatcacc
ggcacggtggatggcaaggccttcaccgcgcaggtcgagcgcggcaagacgagcaacccg
ctggccatccgtgtgatccacaacggcacacgcctggacgccatcgtcatgcacccgcgc
accgccgatctgcaccgcctgatgccctacaaggcgccgccggacttgagcaagttcgtg
ctctcgcccatgcccggcctgctggtgcaggtggcggtgcaaccggggcaagaggtcaag
gccggcgagcgcgtggccgtgatcgaggccatgaagatggagaacgtgctgctggccagc
gccgacggcgtggtcaaggaaatcaaggcgcaaaagggcgacagcctggcggtggatcag
gccatcgtcgagttcgagtga

DBGET integrated database retrieval system